SecReT6
Protein ID: 410684617
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10709
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]824357..825703 [-]
Productconserved hypothethical protein
NoteTssK
UniProt IDD8NHI4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|410684617|ref|YP_006060624.1| conserved hypothethical protein [Ralstonia solanacearum CMR15]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQMIQPYGWGIRHAQFDTDALASGVLRATELSLFFP
DGELYFAPQADTLPPPLVLDAIPAGVSELTFHLALYPLQDSGGNYREQPEGTTVSRFVSTEAETADLFTE
AESAAITYLKKSVKLLADTEPRDQFIALPIVRVRRTGTGGFELDDSFVAPSLSINASTVLYVRLRRLLDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFAALSHLYHHPDLHPERLFQEMLRLAGALMT
FTKSYTLADLPAYDHDSPGPVFSRLDTIVRELLDTVISTRYFAIALEETRPSFHLGRIDSGKIDDKTSFY
LSVSADMPAAELVEAIPARFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAVEARGMLYE
RMLQAQTITIYAPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|410683947|ref|NC_017589.1|:c825703-824357 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
GTGAGCTATTCCGCCAAAATCCTCTGGGGCGAAGGGCTGTTCCTGCGGCCCCAGCATTTCCAGCGCCAGG
ACGCGTACCACGAGTCCCGCCTGCATGCGACCGCGCAGATGATCCAGCCGTACGGATGGGGCATCCGCCA
TGCGCAGTTCGACACCGACGCCCTCGCCAGCGGCGTGCTGCGCGCGACCGAGCTGTCGCTGTTCTTTCCG
GACGGCGAGCTGTACTTCGCGCCGCAGGCCGACACCCTGCCGCCGCCGCTCGTGCTCGACGCCATCCCGG
CCGGCGTGTCGGAGCTGACCTTCCACCTCGCGCTCTATCCGCTGCAGGACAGCGGCGGCAACTACCGCGA
GCAGCCCGAGGGCACCACCGTGTCGCGCTTCGTCTCGACCGAGGCCGAAACGGCGGACCTGTTCACCGAG
GCCGAGTCCGCCGCTATCACCTACCTCAAGAAGTCGGTGAAGCTGCTGGCGGACACCGAGCCGCGCGATC
AGTTCATCGCGCTGCCCATCGTACGGGTGCGCCGGACGGGCACCGGCGGCTTCGAGCTGGACGACAGCTT
CGTCGCGCCGAGCCTGTCGATCAATGCCTCCACCGTGCTGTACGTGCGCCTGCGCCGGCTGCTGGACGCG
CTGCAGGCCAAGGTCAACGCGCTGTACGGCTTCCACCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGATATTGCATCGTTCTGGCTGCTGCACACGGCCAATGCCGCCTTTGCGGCGCTGTCGCACCTCTA
TCACCACCCTGACCTGCATCCCGAGCGGCTGTTCCAGGAGATGCTGCGCCTGGCCGGCGCACTGATGACG
TTCACCAAGAGCTACACCCTGGCCGACCTGCCCGCCTACGACCACGACAGCCCCGGCCCGGTGTTCTCGC
GGCTGGACACCATCGTGCGCGAGCTGCTCGATACCGTGATCTCCACGCGCTACTTCGCGATCGCGCTGGA
GGAGACGCGGCCTTCGTTCCATCTCGGCCGGATCGACTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTCTCCGTGTCGGCCGACATGCCGGCGGCGGAACTGGTGGAGGCGATTCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTCGACAAGCTGGTGCTGTCGTCCATGCCGGGCGTGCCGCTCACCTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGTCCGGGCGCGTGCTACTTCGCGGTCGAGGCACGCGGCATGCTGTACGAA
CGCATGCTGCAGGCCCAGACCATCACCATCTATGCCCCGGCCGGCATCCGGGAACTCAAACTTGAACTCA
TCGCGGTGACTTCATGA