SecReT6
Protein ID: 410684618
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10710
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]825747..826421 [-]
Productconserved exported protein of unknown function
NoteTssJ
UniProt IDD8NHI5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-36, Aligned region: 35..194
Protein Sequence: 224 a.a.     [Download]
>gi|410684618|ref|YP_006060625.1| conserved exported protein of unknown function [Ralstonia solanacearum CMR15]
MKNIEFKAATRLPGRGSRRLVATGLKLAVAGMAVIALTACSTGASVLAGAASGALEAVGLKASNVPDAQK
PPREVPLKLTAGANLNAATDRRPVTLVVRLYALKDPTSFLQAPYDTFIDPAREKQTLGADLVQVREMTLI
PGQRYEFSEKVSREASTLGVVALFRSPAAQRWKFAFNAEKNEKSGIMIGLHACAMTLTTGSPTTPAGSAP
LSDLNLLSPASCGG
 
Nucleotide Sequence: 675 bp     [Download]
>gi|410683947|ref|NC_017589.1|:c826421-825747 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGAAGAATATTGAATTCAAGGCTGCAACCAGGCTGCCGGGCCGCGGCAGCCGGCGCCTCGTCGCGACCG
GGCTCAAGCTGGCGGTCGCTGGAATGGCCGTGATCGCCCTGACCGCCTGCTCGACCGGCGCCAGCGTGCT
GGCGGGCGCCGCCAGCGGTGCGCTGGAGGCCGTGGGGCTGAAGGCATCGAACGTGCCGGACGCGCAGAAA
CCACCCCGCGAGGTTCCGCTCAAGCTGACCGCCGGAGCTAACCTGAACGCGGCGACGGACCGCCGCCCGG
TCACGCTGGTGGTCCGGTTATACGCGCTCAAGGATCCGACCAGCTTCCTGCAGGCGCCATATGACACGTT
TATTGATCCGGCGCGTGAAAAACAGACGCTCGGCGCCGATCTGGTCCAGGTCCGGGAAATGACGCTGATT
CCCGGCCAGCGCTACGAATTCTCGGAAAAGGTCTCGCGTGAAGCCAGTACACTGGGCGTTGTTGCACTAT
TCCGCAGTCCGGCCGCCCAACGATGGAAATTCGCTTTTAATGCGGAAAAGAATGAGAAAAGCGGCATCAT
GATCGGATTGCACGCTTGCGCGATGACCCTGACCACGGGCTCGCCGACCACGCCCGCCGGCAGCGCGCCG
CTATCCGACCTGAACCTGCTTTCGCCGGCAAGCTGCGGCGGCTGA