SecReT6
Protein ID: 410684621
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10713
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]827380..827892 [+]
Productconserved hypothethical protein DUF770
NoteTssB
UniProt IDD8NHI8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.80E-60, Aligned region: 11..164
Protein Sequence: 170 a.a.     [Download]
>gi|410684621|ref|YP_006060628.1| conserved hypothethical protein DUF770 [Ralstonia solanacearum CMR15]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLSGQSEVAQPKMRDRKFVNIDRDNF
DDVMSAAEPRAAFQVQNTLTEEGGRFGVDLKFRSLEDFSPEAVVNQIEPLRQLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTEALQKLGAKTDGGEDA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|410683947|ref|NC_017589.1|:827380-827892 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGCCAAGAAAGAAAGTGTGCAGAAGCGTCTGCAGAAGGTGCGCCCCCCGCGCGTGCAGCTGACGTACG
ACGTTGAAAAGGGCGACGCGATCGAGCAGAAGGAACTGCCGTTCGTGGTCGGCGTGGTGGCGGACCTATC
GGGCCAGTCGGAAGTGGCGCAGCCCAAGATGCGCGATCGCAAGTTCGTCAATATCGACCGCGACAACTTC
GACGATGTGATGTCGGCTGCCGAGCCGCGCGCTGCCTTTCAGGTGCAGAACACGCTGACGGAAGAGGGCG
GCCGCTTCGGCGTCGACCTCAAGTTCCGTTCGCTGGAGGATTTCTCGCCGGAAGCCGTGGTGAACCAGAT
CGAGCCGCTGCGCCAGTTGCTGGAAGCACGCTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGACCTGCTGTCCGAAGTGCTGAACAACACCGAGGCCCTGCAGAAGCTGGGCGCTAAGA
CGGATGGGGGTGAGGATGCTTGA