SecReT6
Protein ID: 410684622
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10714
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]827873..829375 [+]
Productconserved hypothethical protein
NoteTssC
UniProt IDD8NHI9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-192, Aligned region: 72..495
Protein Sequence: 500 a.a.     [Download]
>gi|410684622|ref|YP_006060629.1| conserved hypothethical protein [Ralstonia solanacearum CMR15]
MGVRMLDNQSAALAQSAPAAESVNLLDEIVEQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVSDNLSAT
LDARVAELDRLISSQLSAVMHTPEFQKLEGTWRGLSYLVKETQTSTMLKIKVLNATKRDLVRDFKTAIDF
DQSALFKKVYEEEFGTFGGAPFGTLIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASSSPELLGLESFA
DLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHSKY
LWCNAAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKNSDYAAFFAAQSVQRPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFAS
AKNVETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRL
VADLPKPTNS
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|410683947|ref|NC_017589.1|:827873-829375 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGGGGTGAGGATGCTTGACAACCAATCCGCCGCGCTCGCGCAGAGCGCACCGGCAGCCGAGTCCGTCA
ACCTGCTCGACGAGATCGTCGAGCAGAGCCGCGTCGCCAAGTCGGACGCCGAGCACGCGCGCGCCAAGGA
CATCATCGGCGAGCTGGTCAACCAGGTGCTGCAGGGCACGGTGGTGGTGTCCGACAACCTGTCGGCCACG
CTGGATGCCCGCGTGGCCGAGCTGGACCGCCTGATCTCGTCGCAGCTGAGCGCCGTCATGCACACGCCCG
AGTTCCAGAAGCTGGAGGGCACGTGGCGCGGCCTGTCGTACCTGGTCAAGGAAACGCAGACCAGCACGAT
GCTCAAGATCAAGGTGCTCAACGCCACCAAGCGCGATCTCGTGCGCGACTTCAAGACGGCCATCGATTTC
GACCAGAGCGCGCTGTTCAAGAAGGTGTACGAAGAAGAGTTCGGCACCTTCGGCGGCGCGCCGTTCGGCA
CGCTGATCGGCGATTTCGAAGTCACGCGCCAGCCGGAAGACGTGTACTTCATCGAGCAGATGTCGCACGT
GGCGGCCGCCGCGCATGCGCCGTTCATCGCCTCGTCGTCGCCGGAGCTGCTCGGCCTGGAGTCGTTTGCC
GACCTGGGCAAGCCGCGTGACCTGGCCAAGGTGTTCGATACGGTCGAATACGCCAAGTGGAAGTCGTTCC
GCGAGTCGGAGGATTCGCGCTACGTGGGCCTGACGATGCCGCGCTTCCTGGGCCGGCTGCCGTACAACCC
CAAGGACGGCACCACCGTCGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACCGACCACAGCAAATAC
CTGTGGTGCAACGCGGCCTGGGCGTTCGGCGCGCGGCTGACCGCCGCATTCGAAGACTTCGGCTGGTGCG
CGGCGATCCGCGGCGTGGAAGGCGGCGGGCTGGTCGAAGACCTGCCGACGCATACCTTCAAGACCGACGA
CGGCGAAATCGCGCTCAAGTGCCCGACGGAAATCGCCATCACCGATCGCCGCGAGAAGGAGCTGAGCGAC
CTGGGTTTCATCCCGCTCGTGCACTGCAAGAACTCGGACTACGCCGCGTTCTTTGCCGCGCAGTCGGTGC
AGCGGCCCAAGAAGTACGACACCGACAGCGCGAATGCCAACGCGGTGCTGTCGGCGCAGCTGCAGTACAT
CTTCTCGGTATCGCGCGTGGCGCACTACCTGAAGGCAATGATGCGCGACAAGATCGGCAGCTTTGCATCG
GCCAAGAATGTCGAGACCTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTGGACGACAACGCGACCC
AGGAGCAGAAGGCGCAGTTCCCGCTGCGCGAGGCTTCGATCCAGGTGTCCGAAGTGCCCGGCAAGCCCGG
TACGTACCGCTCGGTGGCGTTCTTGCGGCCGCACTTCCAGCTCGATGAACTGTCGATCTCGCTGCGGCTG
GTGGCGGATCTGCCGAAGCCAACCAATTCCTGA