SecReT6
Protein ID: 410684624
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10716
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]830027..830500 [+]
Productputative secretion system protein (EvpE-like)
NoteTssE
UniProt IDD8NHJ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-19, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|410684624|ref|YP_006060631.1| putative secretion system protein (EvpE-like) [Ralstonia solanacearum CMR15]
MKGFEPSLLDKLFDDEPHAPMPTALRQLSLEELKSTVARDIESLLNTRIVFEEDDLQSLPECKRSLLTYG
LNDFAGLSLASFYDRNYICQSLTKAIERHEPRLQQVSVSLEINERATNALCFGITAVLLVGPAREPVSFD
AMLQPSTLRYSVSRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|410683947|ref|NC_017589.1|:830027-830500 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGAAAGGTTTCGAACCCAGCCTGCTCGACAAGCTCTTCGACGATGAGCCGCATGCTCCCATGCCCACGG
CTCTGCGGCAGCTTTCGCTGGAAGAGCTCAAGAGCACGGTGGCGCGCGATATCGAGTCCTTGCTCAATAC
GCGCATCGTCTTTGAAGAGGACGACCTGCAGAGCCTGCCCGAATGCAAGCGGTCGCTGCTGACCTACGGG
CTGAACGATTTCGCGGGCCTGAGCCTCGCCAGTTTCTACGACCGCAATTACATCTGCCAGTCGCTCACCA
AGGCGATCGAGCGGCACGAGCCGCGGCTGCAGCAGGTCAGTGTCTCGCTTGAAATCAACGAGCGGGCGAC
CAACGCGCTGTGCTTCGGCATCACTGCGGTCTTGCTGGTCGGGCCGGCGCGCGAGCCCGTGAGCTTTGAC
GCGATGCTGCAGCCGTCCACGCTGCGGTATTCCGTCTCGCGTGGGCGCGGCTGA