SecReT6
Protein ID: 410684625
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10717
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]830563..832413 [+]
Productputative Type VI secretion protein (DUF879)
NoteTssF
UniProt IDD8NHJ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-210, Aligned region: 4..615
Protein Sequence: 616 a.a.     [Download]
>gi|410684625|ref|YP_006060632.1| putative Type VI secretion protein (DUF879) [Ralstonia solanacearum CMR15]
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFALLSARVSKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSVVHFDVRGVAAQLSAPVQIPRGTFLTSRVVRKVECRFRTAYDVTFAPVRI
AEAAYERAVSAPSAVSLPKGATGAIALTLEYVGERGGFESLPLDRLRIYMDGEPSFVAALGDALFLHTAG
AYVEGERPGVWTRLSGVPLQEVGFAEDEALIDCPARSHPAYRLLTEHFSFAEKFNFFDIDLAAVRRGLTP
GVPVRRLVLHLVLKDVRSDSHAARLLEGLQADHLRLHCTPVVNLFQQNADPIRIEHTASAYPVVADSRRA
HGFDIYSIDKVHLVRETAAHEEVTEFRPFYSLHHGEEPGHAGHYWIARRNELVAQRSPGFETEISIVDTR
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPDGDLSMEGNTVARAITFLRKPTPSMRLGGGRAAQWRLIS
MLSLNHLSLVQNGLPTLKEMLRLHDLPHSAISARQIEGVVGLDYAPATHWLAGKPFATFVRGLEIRLTLD
EDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSGKELVRCAPRSGESILV
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|410683947|ref|NC_017589.1|:830563-832413 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGAAGAGCTGCTGCCCTATTACGAACGAGAACTGGCCTTCCTGCGCCGGTACTCGCGCGATTTCGCCG
AGCGTTATCCGAAGATCGCAGGCCGGCTCGCCATGTCGGGCGACGGCTGCGACGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTGAGCGCCCGCGTCAGCAAGAAGCTGGACGACGACTACCCCGAATTC
ACCGAGGCGCTGCTGGAGGTCCTGTACCCCCATTACCTGCGTCCGTTCCCGTCGTGCTCCGTGGTGCATT
TCGATGTGCGCGGCGTGGCGGCCCAGCTCAGCGCGCCGGTGCAGATTCCGCGCGGCACGTTCCTGACCTC
GCGCGTGGTGCGCAAGGTCGAGTGTCGCTTCCGCACCGCCTATGACGTCACCTTCGCGCCGGTGCGGATT
GCCGAGGCGGCCTACGAGCGTGCTGTGTCCGCGCCGTCGGCGGTCAGCCTGCCCAAGGGGGCGACCGGCG
CGATCGCGTTGACGCTGGAATACGTTGGCGAGCGCGGCGGCTTCGAGTCCCTGCCGCTCGACCGGCTGCG
CATCTACATGGACGGCGAGCCCTCGTTCGTGGCCGCGTTGGGGGATGCGCTGTTCCTGCATACCGCGGGG
GCTTATGTTGAAGGCGAGCGGCCGGGGGTGTGGACCCGCTTGTCCGGTGTGCCCCTGCAAGAGGTCGGCT
TCGCGGAAGACGAGGCGCTGATCGACTGCCCGGCGCGCTCGCATCCGGCCTATCGGCTGCTGACCGAGCA
CTTCAGCTTTGCCGAGAAATTCAATTTCTTCGACATCGACCTGGCGGCCGTGCGGCGCGGGCTGACGCCT
GGCGTGCCGGTTCGCCGCCTGGTGTTGCACCTGGTCCTGAAGGACGTGCGCAGCGACTCGCACGCTGCCC
GCCTGCTCGAGGGTCTGCAGGCCGACCATCTGCGCCTGCATTGCACGCCGGTGGTCAACCTGTTCCAGCA
GAATGCCGATCCGATCCGTATCGAGCACACCGCCAGCGCCTACCCGGTCGTGGCCGACAGCCGCCGCGCG
CACGGCTTCGATATCTACTCGATCGACAAGGTGCACCTGGTGCGCGAGACCGCCGCGCACGAAGAGGTGA
CCGAGTTCCGCCCGTTCTATTCGCTGCACCACGGCGAGGAGCCCGGGCACGCGGGCCACTACTGGATCGC
CCGGCGCAACGAGCTGGTGGCGCAGCGCAGCCCCGGCTTCGAGACCGAGATCTCCATCGTCGATACCCGG
TTCGATCCGGCCAGCCCGCAGACCGACACGCTGAGCCTGACCGTCACCTGCACCAACCGCGATCTGCCGT
CCACGCTGGCGTTCGGCCAGCCGGACGGCGACCTGTCGATGGAAGGCAACACCGTCGCTCGCGCCATCAC
GTTCTTGCGCAAGCCGACGCCGTCGATGCGCCTGGGCGGAGGCCGCGCGGCGCAGTGGCGGCTGATTTCG
ATGCTCTCGCTCAACCACCTGTCGCTGGTGCAGAACGGGCTGCCGACGCTCAAAGAGATGCTGCGCCTGC
ATGATCTGCCGCACAGCGCCATTTCGGCGCGGCAGATCGAGGGCGTGGTCGGCCTCGACTATGCGCCGGC
CACGCACTGGCTGGCCGGCAAGCCGTTCGCCACGTTTGTGCGGGGGCTGGAGATCCGGCTCACGCTGGAC
GAAGACGCCTTCGTCGGCACGGGCCTGCATCGCTTCATCCGCGTGCTGGACCACTTCTTCGGCCTGTACG
TCCATATCAACAGCTTTGTGCAGCTGATTGCGGTATCGCGCCGCAGCGGCAAGGAACTGGTCAGATGCGC
ACCCCGCAGCGGCGAATCGATCCTGGTGTGA