SecReT6
Protein ID: 410684626
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10718
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]832377..833468 [+]
Productputative Type VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDD8NHJ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-90, Aligned region: 18..344
Protein Sequence: 363 a.a.     [Download]
>gi|410684626|ref|YP_006060633.1| putative Type VI secretion protein, VC_A0111 family [Ralstonia solanacearum CMR15]
MRTPQRRIDPGVIRRLLRQPHRYEFFQAVRLLEQLFARRGNAVPEHALATRVSFRNTLSLSFPPSELQAI
EAARVTPDMLESDAAFIAALEDGVLDTVAITPTFFGMLGVQGALPLRYTEIVAEREAVWRDRAARAFFDI
FSNRATALFYLAWKKYRLPFQYEVDANRHYLPLLLSLAGAADETLRRDLSDTPGPVHDEALAGYATAIRH
RPVSAAYLQRVLADYFRAPTRVEQFVGNWYRVPPSQYSRLGGTNNVLGATALAGARVWQRDLRVRVWVGP
LARAQYRNFLPGAPGALALRKMLTILCGATLEFEIKLILRRQDVAGCTLGAQDSGRIGWDTFLCSHPAQH
DRSDAQYTLAPLH
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|410683947|ref|NC_017589.1|:832377-833468 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGCGCACCCCGCAGCGGCGAATCGATCCTGGTGTGATCCGCAGGCTGCTGCGGCAGCCGCACCGGTACG
AGTTCTTCCAGGCCGTGCGGCTGCTGGAGCAGCTGTTCGCGCGCCGGGGCAACGCCGTGCCCGAGCATGC
GCTAGCCACGCGCGTGAGTTTCCGCAACACGCTGTCGCTGTCGTTCCCGCCCAGCGAGCTGCAGGCCATC
GAGGCGGCTCGCGTGACGCCCGACATGCTGGAGAGCGATGCGGCCTTCATCGCGGCGCTCGAGGACGGCG
TGCTCGATACCGTGGCCATCACGCCGACCTTCTTCGGCATGCTGGGTGTCCAGGGGGCGCTGCCGCTGCG
CTACACCGAGATCGTCGCCGAGCGTGAGGCCGTGTGGCGCGACCGTGCCGCGCGGGCCTTCTTCGACATC
TTCTCGAACCGCGCGACGGCGCTGTTCTACCTAGCGTGGAAGAAGTACCGCCTGCCGTTCCAGTACGAGG
TCGACGCCAACCGGCATTACCTGCCGCTGCTGCTGTCGCTGGCCGGCGCCGCAGACGAGACGCTGCGCCG
CGATCTGTCCGACACGCCGGGGCCGGTCCATGACGAGGCGCTGGCCGGCTATGCCACGGCGATCCGGCAT
CGGCCCGTGTCGGCGGCGTACCTGCAGCGTGTGTTGGCGGACTACTTCCGGGCGCCGACGCGCGTCGAGC
AGTTCGTCGGCAATTGGTATCGCGTGCCGCCGTCGCAGTACTCGCGGCTGGGCGGCACCAACAACGTGCT
GGGCGCCACCGCGCTGGCCGGTGCCCGCGTCTGGCAGCGCGACCTGCGGGTGCGCGTGTGGGTTGGGCCG
CTGGCGCGCGCGCAGTACCGCAACTTCCTGCCGGGCGCGCCGGGCGCGCTGGCACTGCGCAAGATGCTGA
CGATCCTGTGCGGCGCCACGCTCGAATTCGAAATCAAGCTGATCCTGCGCCGCCAGGACGTGGCCGGCTG
CACGCTGGGCGCGCAGGACAGCGGCCGGATCGGTTGGGACACCTTCCTGTGCTCGCATCCGGCGCAGCAC
GACCGCAGCGACGCGCAATACACCCTCGCGCCGCTGCATTGA