SecReT6
Protein ID: 410684627
SecReT6 ID784
T6SS typei4b
Gene symbolclpB
Locus tagCMR15_mp10719
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]833501..836218 [+]
ProductChaperone clpB
NoteTssH
UniProt IDD8NHJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-43, Aligned region: 232..313
AAA_2 [PF07724], Evalue: 2.80E-43, Aligned region: 635..802
AAA [PF00004], Evalue: 2.10E-19, Aligned region: 232..344
AAA [PF00004], Evalue: 2.10E-19, Aligned region: 640..758
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 640..758
ClpB_D2-small [PF10431], Evalue: 4.20E-12, Aligned region: 386..403
ClpB_D2-small [PF10431], Evalue: 4.20E-12, Aligned region: 811..886
Clp_N [PF02861], Evalue: 1.30E-10, Aligned region: 23..75
Clp_N [PF02861], Evalue: 1.30E-10, Aligned region: 114..128
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 614..678
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 706..728
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 636..660
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 701..733
Sigma54_activat [PF00158], Evalue: 3.60E-06, Aligned region: 211..248
Sigma54_activat [PF00158], Evalue: 3.60E-06, Aligned region: 637..740
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 227..262
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 288..328
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 501..503
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 634..657
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 284..369
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 636..676
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 710..733
AAA_19 [PF13245], Evalue: 7.00E-05, Aligned region: 232..258
AAA_19 [PF13245], Evalue: 7.00E-05, Aligned region: 635..661
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 635..664
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 732..766
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 232..295
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 639..675
IstB_IS21 [PF01695], Evalue: 0.00023, Aligned region: 224..254
IstB_IS21 [PF01695], Evalue: 0.00023, Aligned region: 639..657
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 641..664
T2SE [PF00437], Evalue: 0.0019, Aligned region: 214..249
T2SE [PF00437], Evalue: 0.0019, Aligned region: 623..676
NACHT [PF05729], Evalue: 0.0019, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.0019, Aligned region: 427..462
NACHT [PF05729], Evalue: 0.0019, Aligned region: 640..660
Zeta_toxin [PF06414], Evalue: 0.0026, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0026, Aligned region: 631..679
ResIII [PF04851], Evalue: 0.0079, Aligned region: 218..251
ResIII [PF04851], Evalue: 0.0079, Aligned region: 300..314
ResIII [PF04851], Evalue: 0.0079, Aligned region: 443..512
ResIII [PF04851], Evalue: 0.0079, Aligned region: 611..660
Protein Sequence: 905 a.a.     [Download]
>gi|410684627|ref|YP_006060634.1| Chaperone clpB [Ralstonia solanacearum CMR15]
MATPLKTLIAKLNATSRQAAERAASLCMARGNYEVDLEHLFLALLENRRSDFAVAARASGIDPAALQRDL
EAEVGRFQTGNTRTPAFSPYLPKLFEHAWLIASLDSQITRIRSGHLLLALLTEPSLAALAERGSRLFGRF
EVERLKHDFERMTTGSDEQEQAVDFADGTAVQTEDGRTAPAAALTATPALDQFTVDLTQAAREGRIDPVI
GRDAEIRQVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRVAANDVPPPLQGVTLRTLDMGLLQAGASV
KGEFENRLKNVIDEVKKSPKPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVDEPSEPLAAAMLRGMAPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQSATPGAIEDDQKLLERLLGEIAALQREQSAGAAHDARLEALQAQRAELEQRIALNT
ERLARERALVARIQALREARESDAAQADAQDAEPVAANSDVVAMSPKRARAADAPDELATLLAELRALQG
ETPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALDAIAQRVRTASANLE
DPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVL
TEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSAIMQACLNQ
PAEALPDADTLAETLRPVLYKAFKPAFLGRTKVVPYYPIADDVLAEIITLKLGRIRDRVAANHKATFQWD
TALVESVLARCTEVDAGARAVDHILNGTLLPEIAEAVLTRMAEGGSVEKIKVSVGKTGEFKYRIN
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|410683947|ref|NC_017589.1|:833501-836218 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGCCACCCCACTCAAGACCTTGATCGCCAAGCTGAACGCGACCAGCCGGCAGGCCGCCGAGCGCGCGG
CGTCGCTGTGCATGGCGCGCGGCAACTATGAAGTCGACCTGGAGCACCTGTTCCTGGCGCTGCTCGAAAA
CCGCCGCAGCGACTTCGCCGTCGCGGCGCGCGCCAGCGGTATCGATCCGGCCGCGCTGCAGCGCGACCTG
GAGGCCGAGGTGGGGCGCTTCCAGACCGGCAACACGCGCACGCCGGCGTTCTCGCCGTATCTGCCCAAGT
TGTTCGAGCATGCGTGGCTGATCGCCTCGCTGGATTCGCAGATCACGCGCATCCGCTCGGGCCACCTGCT
GCTGGCGTTGCTGACCGAGCCCAGCCTGGCCGCGCTGGCCGAACGCGGCTCGCGGCTGTTCGGCCGCTTC
GAGGTGGAACGGCTCAAGCACGATTTCGAGCGCATGACCACCGGCTCGGACGAGCAGGAGCAGGCCGTTG
ATTTTGCCGACGGCACGGCTGTGCAGACGGAAGACGGTCGCACCGCGCCAGCCGCCGCGCTGACCGCGAC
ACCAGCCCTCGACCAGTTCACCGTGGACCTGACGCAGGCTGCCCGCGAAGGCCGCATCGACCCAGTGATC
GGGCGCGACGCCGAGATCCGACAAGTGGTGGACATCCTGATGCGCCGGCGTCAGAACAACCCCATCCTGA
CCGGCGAGGCCGGTGTCGGCAAGACGGCGGTGGTGGAGGGTCTCGCGCTGCGAGTGGCCGCCAACGACGT
GCCGCCGCCGCTGCAGGGCGTGACGCTGCGCACGCTCGACATGGGCCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGCCTGAAGAACGTGATCGATGAGGTCAAGAAAAGCCCGAAGCCGATCATCC
TGTTCATCGACGAGGCGCACACCATCATCGGCGCGGGCGGGCAGGCCGGGCAGAACGATGCGGCCAATCT
GCTCAAGCCGGCACTGGCGCGCGGTGAGCTGCGCACCATCGCCGCGACCACCTGGAGCGAGTACAAGAAG
TATTTCGAAAAGGACGCCGCGCTCGCGCGCCGCTTCCAGGTCGTCAAGGTCGACGAGCCGAGCGAGCCGC
TGGCCGCGGCCATGCTGCGCGGCATGGCGCCGCTGATGGAGCGCCACTTCGGCGTGCGCGTGCTAGACGA
GGCCATCACCGAGGCCGTGCGCCTGTCGCATCGCTACATCAGCGGGCGGCAACTGCCAGACAAGGCGGTC
AGCGTGTTGGACACGGCGTGCGCCAAGGTGGCACTGGGCCAGAGCGCCACGCCGGGCGCCATCGAAGACG
ACCAGAAACTGCTGGAGCGCCTGCTGGGCGAGATCGCCGCGCTGCAGCGCGAGCAGAGCGCCGGCGCGGC
GCACGATGCCCGCCTCGAAGCGCTGCAGGCCCAGCGCGCCGAGCTGGAGCAGCGCATCGCGCTGAACACC
GAGCGCCTGGCCCGGGAGCGTGCGCTGGTTGCACGCATCCAGGCGCTGCGCGAGGCGCGCGAAAGCGATG
CGGCGCAGGCCGACGCGCAGGACGCGGAGCCGGTGGCGGCCAACAGCGATGTGGTGGCGATGTCGCCCAA
GCGTGCCCGCGCCGCCGACGCGCCGGACGAACTGGCCACGCTGCTGGCCGAGCTGCGCGCGCTGCAGGGC
GAGACGCCCATGGTGCCGCTGCAGGTGGACGGCCATGTCGTGTCGGAGATCGTCTCGGCCTGGACCGGCA
TTCCGCTGGGCCGCATGGTCAAGGACGAGCTGCGCACCGTGCTGAACCTCAAGCCGCTGCTGGCCGCGCG
CGTGATCGGCCAGGACCATGCGCTGGACGCCATCGCCCAGCGCGTGCGCACCGCCTCGGCCAACCTGGAA
GACCCGAACAAGCCGCGCGGCGTGTTCTTGTTCGCGGGCCCGTCGGGCGTGGGCAAGACCGAGACGGCGC
TGGCGCTGGCCGACATCCTCTACGGCGGCGAGCGCAAGCTCATCACCATCAACATGAGCGAGTACCAGGA
GGCGCACAGCGTCTCGGGCCTGAAGGGCTCGCCGCCGGGCTACGTGGGCTACGGCGAGGGCGGTGTGCTG
ACCGAGGCGGTGCGCCGCAACCCGTACAGCGTGGTGCTGCTGGACGAAGTCGAGAAAGCCCACCCCGACG
TGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGACGCCGAGGGCCGCCCGATCGACTT
CCGCAACACCATCATCATCCTGACCTCGAACGTGGGCTCGTCGGCCATCATGCAGGCCTGCCTGAACCAG
CCCGCCGAGGCACTGCCCGACGCCGACACCCTGGCCGAGACGCTGCGGCCGGTGCTGTACAAGGCCTTCA
AGCCGGCCTTCCTGGGGCGGACCAAGGTGGTGCCGTACTACCCGATCGCCGACGACGTGCTGGCCGAGAT
CATCACGCTCAAGCTCGGCCGCATCCGCGACCGCGTGGCCGCCAACCACAAGGCGACGTTCCAGTGGGAC
ACCGCGCTGGTGGAATCCGTGCTGGCCCGTTGCACCGAAGTGGATGCCGGCGCGCGCGCGGTCGACCACA
TCCTCAACGGCACGCTGCTGCCCGAGATTGCCGAGGCGGTGCTCACGCGCATGGCCGAAGGCGGCAGCGT
CGAGAAGATCAAGGTCAGCGTCGGCAAGACCGGCGAGTTCAAGTACCGCATCAACTGA