SecReT6
Protein ID: 410684628
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10720
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]836239..838995 [+]
Productputative Rhs element VGR-related protein
NoteTssI
UniProt IDD8NHJ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.00E-69, Aligned region: 42..362
Phage_GPD [PF05954], Evalue: 9.00E-69, Aligned region: 457..467
Phage_GPD [PF05954], Evalue: 9.00E-69, Aligned region: 585..585
Phage_GPD [PF05954], Evalue: 9.00E-69, Aligned region: 623..644
DUF2345 [PF10106], Evalue: 2.00E-39, Aligned region: 627..670
DUF2345 [PF10106], Evalue: 2.00E-39, Aligned region: 724..885
T6SS_Vgr [PF13296], Evalue: 3.50E-26, Aligned region: 585..689
T6SS_Vgr [PF13296], Evalue: 3.50E-26, Aligned region: 772..773
Phage_base_V [PF04717], Evalue: 2.50E-19, Aligned region: 430..532
Protein Sequence: 918 a.a.     [Download]
>gi|410684628|ref|YP_006060635.1| putative Rhs element VGR-related protein [Ralstonia solanacearum CMR15]
MVSPTELANLLRAAFIQANRLLRLDTPLGPNVLLPERLDAAEHLDDGGFRLELTALSDDVDLDPARLLGQ
PVRLDLLTQQSRSALRPFHGHVTRFEQLGANGGLVRYRLVIEPWLAFLRHRRDSFLFQDQSVIEVIDNLF
GDYNGQGRLAPAWRWSLRDASVYTRRSVITQYEESDFDFVTRLLAEEGLFYFFEHEAVEGDALGVHRMVI
ADANDVFADNAQATIRFGRADATANEDVIDRWQGVRRWQTNAVSIASWDYRANTQRSAQLGAQQRRDGIP
QLTLQDTDYPGQYWFEDSAQAQRSAHVVMQALELRDKQFDGEGSARTLAPGTCFQLVDHYDQGDDGEARF
AVLSVRHQARNNFNERFGEVLTQALGALSGVAVQDAGGNTGTDATFYRNHFTVARDTLPYRPQQRDAQGQ
ALHPRPTVEGSQTALVVGVGGPVHTDRDHRIKVQFHWQRGARSASRQSHPAGDDNARADASLGCWVRVSS
PVAGPNWGGVALPRVGQEVLVEFVQGDIDRPVVVGAAYNGSGQRDAQYNQNQAGAAGATGNAPAWFAGDS
KSQGAYAHNAVLSGIKTQALGGSQTGASGYNQLVFDDTDGQSRTQLSTTQAATALTLGHQKEQIDSARQA
DLGHGAALATNDSGSVRAGAGLLLTAHAADTGTALLDSEGAASQIEALSELAESLADVARTQQAGLPEEA
AAQDLPALKQLRHTTEVLRHAESAGKGASAIAYSEPHLQISAPKGIAATTPADAMLVAGTQVTLAAKQDA
NLAAGGNLAMAVADGLTLFAHGKAVGQSSDAARGIAMHAASGKVGLSALKGESRLVAEKAVTVASTQGNV
TAEGKAHVLVNAAGAQIRVTNGTIELHAPGKTIFKGAGHTFVGPGGAAADNTLAQGNLKGCGIQEGNAAT
SGAGSVSR
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|410683947|ref|NC_017589.1|:836239-838995 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGTCTCACCGACCGAGCTGGCCAACCTGCTGCGGGCGGCCTTCATCCAGGCCAACCGGCTGCTGCGCC
TGGACACGCCGCTCGGGCCGAACGTGCTGTTGCCCGAGCGGCTGGACGCGGCCGAGCATCTCGACGATGG
CGGCTTCCGGCTGGAGCTGACCGCGCTGTCGGATGACGTCGATCTCGACCCGGCGCGCCTGCTGGGGCAG
CCCGTTCGGCTCGACCTGCTGACCCAGCAGAGCCGCAGCGCGCTGCGGCCGTTTCATGGCCACGTCACGC
GGTTCGAGCAGCTGGGCGCCAATGGCGGCCTGGTGCGCTACCGGCTGGTGATCGAGCCCTGGCTGGCCTT
CCTGCGCCACCGGCGCGACAGCTTCCTGTTCCAGGACCAGTCTGTCATCGAGGTGATCGACAACCTGTTC
GGTGACTACAACGGCCAGGGCCGCTTGGCGCCAGCGTGGCGCTGGTCGCTGCGCGATGCCTCGGTGTACA
CGCGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGATTTCGTCACCCGTCTGCTGGCCGAGGA
AGGGCTGTTCTACTTCTTCGAGCACGAGGCGGTCGAGGGCGATGCGCTGGGCGTGCACCGCATGGTGATC
GCCGATGCCAACGATGTCTTCGCCGACAACGCGCAGGCCACCATCCGCTTCGGCCGCGCCGATGCCACCG
CCAATGAAGACGTGATCGACCGCTGGCAGGGCGTGCGGCGCTGGCAGACCAACGCCGTGTCGATCGCCAG
TTGGGACTACCGCGCCAACACTCAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCGGCGCGATGGCATCCCG
CAACTGACGCTGCAAGACACCGACTACCCCGGCCAATATTGGTTCGAAGACAGCGCCCAGGCCCAGCGCA
GCGCGCACGTGGTGATGCAAGCGCTGGAACTGCGCGACAAGCAGTTCGATGGCGAAGGCAGCGCGCGCAC
GCTGGCCCCCGGCACGTGCTTCCAGCTGGTCGATCATTACGACCAGGGCGACGACGGCGAGGCGCGCTTC
GCCGTGCTGTCCGTCCGGCACCAGGCACGCAACAACTTCAACGAGCGCTTTGGCGAGGTGCTGACGCAGG
CGCTGGGCGCGCTGTCCGGCGTCGCCGTGCAAGACGCCGGGGGCAACACTGGCACCGACGCCACGTTTTA
CCGCAACCACTTCACGGTCGCGCGCGACACCTTGCCGTACCGCCCGCAGCAGCGCGATGCGCAAGGGCAG
GCGCTGCATCCGCGTCCGACGGTCGAGGGCAGCCAGACCGCGCTGGTGGTGGGCGTCGGTGGCCCGGTGC
ATACGGACCGCGATCATCGCATCAAGGTCCAGTTTCATTGGCAGCGCGGCGCGCGCTCGGCCAGCCGCCA
GTCGCATCCGGCCGGCGACGACAACGCCCGCGCGGATGCCAGCCTGGGCTGCTGGGTGCGTGTGTCGTCG
CCGGTGGCCGGGCCCAACTGGGGCGGCGTGGCCTTGCCGCGCGTGGGCCAGGAAGTGCTGGTGGAATTCG
TGCAGGGCGACATCGACCGGCCGGTGGTGGTTGGCGCGGCCTACAACGGCAGCGGCCAGCGCGACGCGCA
GTACAACCAGAACCAGGCCGGCGCGGCGGGCGCCACCGGCAACGCCCCGGCCTGGTTCGCCGGCGACAGC
AAGAGCCAGGGGGCGTACGCGCACAACGCCGTGCTGTCCGGCATCAAGACGCAGGCGCTGGGTGGCAGCC
AGACGGGTGCCTCGGGCTACAACCAGCTCGTCTTCGACGACACCGACGGCCAGAGCCGCACGCAACTGAG
CACCACCCAGGCCGCCACCGCGCTCACACTGGGCCACCAGAAGGAGCAGATCGACAGCGCCCGCCAGGCC
GACCTCGGCCACGGCGCGGCGCTGGCCACCAACGACAGCGGCAGCGTGCGCGCCGGCGCGGGCTTGCTGC
TCACCGCGCATGCGGCGGATACCGGCACCGCGCTGCTCGACAGCGAAGGCGCCGCCAGCCAGATCGAAGC
CCTCAGCGAACTGGCCGAATCGCTGGCCGACGTGGCCCGGACGCAGCAGGCCGGCCTGCCGGAAGAGGCT
GCCGCGCAAGACCTGCCCGCGCTCAAGCAGCTGCGGCACACCACCGAAGTGCTGCGCCACGCCGAAAGCG
CCGGCAAAGGCGCCTCGGCCATCGCCTACAGCGAACCGCATCTGCAGATCTCCGCACCGAAGGGCATCGC
CGCGACCACGCCGGCCGACGCCATGCTGGTGGCTGGCACCCAGGTCACGCTGGCGGCCAAGCAGGACGCC
AACCTTGCGGCGGGCGGCAACCTGGCAATGGCGGTGGCGGACGGCCTGACCCTGTTCGCGCACGGCAAGG
CGGTGGGCCAGTCATCCGACGCGGCCCGGGGGATCGCGATGCATGCGGCGAGCGGCAAGGTGGGTTTGAG
TGCCCTGAAGGGCGAGAGCCGGCTGGTGGCCGAGAAGGCCGTGACGGTGGCATCCACGCAGGGCAACGTC
ACGGCGGAGGGCAAGGCGCATGTGCTGGTGAATGCGGCGGGCGCGCAGATCCGGGTGACCAACGGGACGA
TCGAGTTGCATGCGCCGGGGAAGACGATCTTTAAGGGGGCGGGGCATACGTTTGTGGGGCCGGGTGGGGC
GGCGGCGGATAACACATTGGCCCAAGGCAACCTGAAGGGGTGCGGTATCCAGGAAGGTAACGCCGCTACC
AGTGGAGCAGGGTCGGTTTCGCGTTGA