SecReT6
Protein ID: 410684635
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10727
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]846537..847616 [+]
Productconserved hypothethical protein
NoteTssA
UniProt IDD8NHK2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-26, Aligned region: 56..117
ImpA-rel_N [PF06812], Evalue: 1.60E-26, Aligned region: 231..249
Protein Sequence: 359 a.a.     [Download]
>gi|410684635|ref|YP_006060642.1| conserved hypothethical protein [Ralstonia solanacearum CMR15]
MATLQFDQLLAPLAGPTPCGEDMLFSTEFDTIQEARRFDDPSLDQGDWVTEIKEADWRAVVSESTALLQK
RTKDLRLAAWLTEALSKERGFAGLREGYELIAGLCEQYWEHLFPLPEPDDPEARTGSMAWLAGRSSQLIR
EVPLVEAGKGGFNYVDWEVATNLIEAIRRDPDQADELSRGKVTQDQFEAARRASSSAFYTALYNDVVGCG
AALLRLESVLDGRAGDHAPSFRAAREALQAVRALVERFGGKTETKPSAAEPKATTAPQQTAQPVAEAVPD
TVVGPIRTRVQALNQLREVAEFFRQTEPHSPVAYLAARAAKWGDMPLHAWLRAVVKDDATLSQIEEMLGL
GDPPADSAD
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|410683947|ref|NC_017589.1|:846537-847616 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGCAACCCTCCAGTTCGACCAGCTTCTTGCGCCGCTCGCCGGCCCCACGCCTTGCGGCGAGGACATGC
TCTTCTCCACGGAATTCGACACCATCCAGGAAGCGCGCCGCTTTGACGACCCTTCGCTCGATCAGGGCGA
CTGGGTGACCGAGATCAAGGAGGCGGACTGGCGGGCCGTCGTCTCGGAAAGCACGGCGTTGCTGCAGAAG
CGCACCAAGGACTTGCGCCTGGCCGCGTGGCTGACCGAGGCGCTGTCCAAGGAGCGCGGCTTTGCCGGCC
TGCGCGAGGGCTACGAGCTGATCGCGGGGCTGTGCGAGCAGTACTGGGAGCACCTCTTCCCGCTGCCCGA
GCCGGATGATCCCGAGGCGCGCACCGGCAGCATGGCGTGGCTGGCGGGGCGCTCCAGCCAGCTGATCCGC
GAGGTGCCGCTGGTGGAGGCGGGCAAGGGCGGCTTCAACTATGTCGACTGGGAAGTCGCCACCAACCTGA
TCGAGGCGATCCGGCGCGATCCGGACCAGGCGGATGAGCTGTCGCGTGGCAAAGTCACGCAGGATCAGTT
CGAGGCGGCGCGCCGCGCGTCGTCTTCGGCGTTCTACACGGCGCTGTACAACGATGTGGTCGGCTGCGGC
GCGGCGCTGCTGCGGCTGGAATCCGTGCTGGACGGGCGCGCCGGGGATCACGCGCCGAGTTTCCGCGCCG
CGCGCGAAGCCTTGCAGGCGGTCCGCGCCCTGGTCGAGCGTTTCGGCGGCAAGACGGAAACCAAGCCCAG
CGCGGCCGAGCCCAAGGCCACCACCGCGCCGCAGCAGACCGCCCAGCCCGTCGCCGAGGCCGTGCCCGAT
ACCGTGGTCGGCCCGATCCGCACGCGCGTCCAGGCGCTGAACCAGCTGCGCGAGGTGGCCGAGTTCTTCC
GCCAGACCGAGCCGCACAGCCCGGTAGCCTACCTCGCCGCGCGCGCGGCCAAGTGGGGCGACATGCCGCT
GCACGCCTGGCTGCGCGCGGTGGTCAAGGACGATGCGACGCTGTCGCAGATCGAAGAAATGCTGGGGTTG
GGCGATCCGCCGGCGGATAGCGCGGATTGA