SecReT6
Protein ID: 410684644
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10736
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]858342..861362 [+]
Productconserved hypothethical protein, VGR related protein
NoteTssI
UniProt IDD8NHL1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-56, Aligned region: 37..354
Phage_GPD [PF05954], Evalue: 1.80E-56, Aligned region: 720..720
DUF2345 [PF10106], Evalue: 1.30E-37, Aligned region: 177..201
DUF2345 [PF10106], Evalue: 1.30E-37, Aligned region: 768..928
T6SS_Vgr [PF13296], Evalue: 3.00E-34, Aligned region: 614..724
T6SS_Vgr [PF13296], Evalue: 3.00E-34, Aligned region: 887..909
T6SS_Vgr [PF13296], Evalue: 3.00E-34, Aligned region: 964..990
Phage_base_V [PF04717], Evalue: 1.90E-20, Aligned region: 450..549
Protein Sequence: 1006 a.a.     [Download]
>gi|410684644|ref|YP_006060651.1| conserved hypothethical protein, VGR related protein [Ralstonia solanacearum CMR15]
MDVTTLLQNLFAPAHRLYALEGEGPIAELAVEAWLGREALSELFEWRVVAASANARIALEAFIGQRVTLV
TTLADGTQVRRTGLIRQAEQLGADGSLARYRLTVVPWFWLATQQRHSQVFQNRPLGGIFEQVLSPYAPYA
AWRFTAGAEDRMAAFGTRKHIAQFRETDYCFVTRLLAEAGLGFTTVEDAQAPSGHTLLIFADSPRLAEDT
ESAAEGGIRYHRAHSQEERDAIQELICHSRTAVGGVAVAAWDAQAKRAFRAHVPSRLCGIAGSPDSYLSI
SPSLAPDTANAQRIAEQVMESVEVRARLFIGRGTVRTLRSGTRLKVVDCPHLPKDVDGPYPLLIDLVEHC
GINNLTADTQAVLGQKLGGLDAALTFDTPPSPPESGPGPFGFMTPHEVIERFTPAADLLTAARAHGYAGQ
FRASDARRPWRPVVSHPDTGRLYSEPTAKGVQSAIVVGPNGEAEASGEAEHHTNPRGQIRVRFPWQQGDR
PDDRSSRWLPVAQRQAGAGMGWQWIPRIGQEVLVKFQEDDIDLPVVIGALYNGQGEAGIAPTPGGQAAKG
ARQEATPETLYRLGSDSAASAQGNLAAGHSPAWHGLGTEAEGHRNAAALSGFKSAEHGGRGANLLVFDDS
DGQLRTQLATTQAHSQLNLGHLIHQQDNRRGSFRGQGFELRTDGYGAVRGQAGVLLTTYRDATSGQAVPT
GDNAAGIALIRQAKQLTASLSQGATTHQTAALSTAKDDNAPLAKQEKAALGMVDGKALDTAQQDAAAGNT
NTQGKVPHPSEATVHLVGRAGLVAIAGQDLQLANGESIALASGQDTSVAVGKQARIHAGQAIGVAAGLSK
AGDDNIGLQLTAGQDNLDVQAQHDTLGLLSKDDLKLVSANLHVDFAAAKRIRLATAAGASITLEGGNIIV
ETPGRITYKAAQRTFAGRTHASREMNTWPHSAFDDRYVLRDQVTHEPLRNTQVELRRGDGAVLKLVTDEE
GRLPVQKGISMERVQLRVLGKLSGKT
 
Nucleotide Sequence: 3021 bp     [Download]
>gi|410683947|ref|NC_017589.1|:858342-861362 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGGACGTAACGACCCTTCTCCAGAATCTCTTCGCCCCCGCGCACCGCCTGTATGCGCTGGAAGGCGAAG
GCCCGATCGCGGAACTGGCGGTGGAGGCGTGGCTTGGCCGCGAGGCATTGTCCGAGCTGTTCGAATGGCG
GGTGGTAGCTGCCAGCGCCAATGCGCGCATCGCGCTCGAAGCGTTCATCGGTCAGCGCGTGACGCTGGTC
ACCACATTGGCCGACGGCACGCAGGTCAGGCGCACCGGCCTGATCCGGCAGGCCGAGCAGCTCGGCGCCG
ATGGCAGCCTGGCGCGCTATCGCCTGACCGTGGTGCCGTGGTTCTGGCTGGCGACGCAGCAGCGGCACAG
TCAGGTGTTCCAGAACCGGCCACTGGGGGGCATCTTCGAACAGGTGCTGTCGCCGTATGCGCCCTACGCT
GCTTGGCGCTTCACCGCCGGCGCGGAAGACCGCATGGCGGCGTTCGGCACGCGCAAGCACATCGCCCAGT
TTCGCGAGACCGACTACTGCTTCGTCACCCGCCTGCTGGCTGAGGCGGGCCTGGGCTTCACCACCGTCGA
GGACGCGCAGGCGCCCAGCGGCCACACACTGCTGATCTTTGCCGACAGCCCCCGGCTGGCCGAGGACACC
GAATCCGCCGCCGAGGGCGGCATCCGTTATCACCGCGCGCACAGCCAAGAAGAGCGCGACGCCATTCAGG
AGTTGATCTGCCACAGCCGCACGGCGGTGGGCGGGGTGGCGGTGGCGGCCTGGGATGCGCAGGCCAAGCG
GGCCTTCCGCGCGCACGTTCCCTCCCGGCTTTGCGGTATCGCGGGCAGTCCGGATAGCTACCTGTCGATT
AGCCCGTCGCTGGCACCGGATACGGCCAACGCCCAGCGCATCGCCGAACAGGTGATGGAGAGCGTCGAGG
TGCGCGCCAGGCTCTTTATCGGACGCGGTACGGTACGCACGCTGCGCAGCGGCACGCGGCTGAAGGTCGT
GGATTGCCCGCACCTGCCGAAGGACGTGGACGGCCCGTACCCGTTGCTGATCGACTTAGTGGAGCACTGC
GGCATCAACAACCTGACCGCCGACACCCAAGCCGTGCTGGGTCAGAAGCTGGGCGGGCTCGACGCCGCAC
TGACCTTCGACACGCCACCCAGCCCACCCGAATCCGGCCCCGGCCCGTTCGGCTTCATGACGCCACACGA
GGTCATCGAACGCTTCACGCCGGCAGCAGACCTGCTCACCGCCGCGCGCGCCCACGGCTACGCCGGCCAG
TTCCGCGCGAGCGACGCACGCCGCCCGTGGCGGCCGGTCGTGTCACACCCCGACACCGGCCGCCTGTACT
CTGAGCCCACCGCCAAGGGCGTGCAGAGCGCCATCGTGGTCGGCCCAAACGGCGAGGCCGAGGCCAGCGG
GGAGGCGGAACACCACACCAACCCACGGGGCCAGATCCGCGTCCGCTTCCCGTGGCAGCAGGGCGACCGC
CCGGACGACCGCAGCAGCCGCTGGCTGCCGGTCGCGCAGCGGCAGGCGGGGGCCGGCATGGGCTGGCAGT
GGATACCGCGCATCGGCCAGGAAGTTCTGGTCAAGTTCCAGGAAGACGATATCGACTTGCCGGTGGTGAT
CGGCGCGCTCTATAACGGCCAGGGCGAAGCGGGCATCGCGCCGACCCCCGGTGGGCAGGCCGCCAAGGGC
GCCAGACAGGAGGCCACCCCGGAGACCCTGTACCGTCTGGGCAGCGACAGCGCCGCCAGCGCGCAGGGCA
ACCTCGCCGCCGGCCACAGCCCGGCATGGCATGGCCTGGGCACCGAGGCTGAAGGCCACCGCAACGCCGC
CGCTCTCAGCGGCTTCAAGAGCGCCGAGCACGGCGGGCGTGGTGCCAACCTGCTCGTCTTCGACGATAGC
GATGGCCAGTTGCGCACGCAGCTCGCCACCACGCAAGCTCACAGCCAACTGAACCTGGGCCACCTGATCC
ATCAGCAGGACAACCGACGTGGCAGCTTCCGGGGCCAGGGCTTCGAGTTGCGCACGGATGGCTATGGCGC
GGTGCGAGGCCAGGCCGGTGTGCTGCTGACTACCTACCGCGACGCCACGAGCGGCCAAGCGGTGCCGACC
GGCGACAACGCGGCCGGCATCGCGCTGATCCGGCAGGCCAAGCAGCTCACCGCATCGTTGAGCCAGGGCG
CCACCACGCATCAGACTGCAGCGCTGTCCACCGCGAAGGATGACAATGCCCCGCTGGCCAAGCAGGAGAA
GGCCGCTTTGGGCATGGTCGACGGCAAGGCGCTCGATACGGCCCAGCAGGACGCAGCCGCAGGCAACACC
AACACGCAAGGCAAGGTGCCACACCCTAGCGAAGCGACGGTGCACCTGGTCGGCCGCGCGGGCCTGGTGG
CGATCGCCGGTCAGGACCTGCAGTTGGCTAACGGTGAGAGCATCGCACTGGCCAGCGGCCAGGACACCAG
CGTCGCAGTGGGCAAGCAGGCACGCATCCATGCCGGACAAGCCATCGGCGTGGCGGCGGGGCTGTCGAAG
GCGGGGGACGACAACATCGGCCTGCAGCTGACGGCGGGGCAGGACAACCTCGACGTACAGGCGCAGCATG
ACACGCTCGGGCTGCTGTCCAAGGACGACCTGAAGCTGGTGTCGGCGAATCTGCATGTGGACTTCGCGGC
GGCCAAGCGGATTCGGCTGGCGACGGCAGCGGGGGCGTCGATCACGCTGGAGGGTGGGAACATCATCGTC
GAGACGCCGGGGCGGATTACGTACAAGGCAGCGCAGCGCACCTTTGCGGGGCGCACGCACGCGTCGCGCG
AGATGAACACGTGGCCGCACAGTGCGTTTGATGACAGATACGTCTTGCGCGACCAAGTCACGCACGAGCC
GCTGCGAAATACGCAGGTCGAGTTGCGGCGCGGTGACGGGGCTGTACTCAAGCTGGTCACGGATGAGGAG
GGCCGCCTCCCTGTGCAGAAGGGTATTTCCATGGAGCGCGTGCAACTGCGTGTGCTGGGAAAGCTCTCCG
GCAAAACCTAA