SecReT6
Protein ID: 422938073
SecReT6 ID780
T6SS typeii
Gene symbol-
Locus tagFTS_0107
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]115420..115941 [-]
Producthypothetical protein
NoteIglG
UniProt IDK0E8I7
KEGG IDfti:FTS_1135, fti:FTS_0107
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|422938073|ref|YP_007011220.1| hypothetical protein FTS_0107 [Francisella tularensis subsp. holarctica FSC200]
MLNIINDSLKRLKEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c115941-115420 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGAAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG