SecReT6
Protein ID: 422938851
SecReT6 ID781
T6SS typeii
Gene symboliglA2
Locus tagFTS_1125
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1099462..1100016 [+]
ProductiglA protein
NoteIglA
UniProt IDK0E8C0
KEGG IDfti:FTS_0097, fti:FTS_1125
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.10E-42, Aligned region: 4..156
Protein Sequence: 184 a.a.     [Download]
>gi|422938851|ref|YP_007011998.1| iglA protein [Francisella tularensis subsp. holarctica FSC200]
MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFAYREVRRVNNGVDRVLEEMN
ISFDFEAPNFVSKDPSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTID
MIFSDSNELESLKSKIPALTNYTIKDSCDAAGSQDLSNQQVDGK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|422937995|ref|NC_019551.1|:1099462-1100016 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGGCAAAAAATAAAATCCCAAATTCAAGGTTGATGATAAATTATGAAACTAATGTTGATGGTGTCTTAA
AGAAAAAAGAGCTACCTTACAGAGTCCTAGTTGTTGGCGATTTATCAAAAGGAAGATCTGTGGATGCAAA
AAAAGAGTTCGCATATAGAGAGGTCAGAAGAGTAAATAATGGTGTTGATAGGGTTTTAGAAGAGATGAAT
ATATCTTTTGATTTTGAGGCACCAAACTTTGTTTCTAAAGATCCTAGTAATTTAAAAGTTAATTATAGAA
TTGAAAGTGTCAAAGATTTTAGACCTGATGCTGTTGCTAAAAAAGTTCCTGAAATCAGAGCGCTGCTTGA
AATGAAAGAGATATTAGCATCCTTTGCTAAGGACATTGAAAATAATCGTAATCTCAAGAAAACCATAGAT
ATGATTTTTTCAGATAGTAACGAATTAGAATCATTAAAGAGTAAGATTCCTGCTTTGACAAATTATACGA
TTAAAGACTCTTGTGATGCTGCTGGGTCTCAAGACTTAAGTAATCAACAAGTAGATGGTAAGTAG