SecReT6
Protein ID: 422938854
SecReT6 ID781
T6SS typeii
Gene symboliglD2
Locus tagFTS_1128
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1102217..1103413 [+]
Productintracellular growth locus protein D
NoteIglD
UniProt IDK0E617
KEGG IDfti:FTS_1128, fti:FTS_0100
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00095, Aligned region: 43..103
DUF876 [PF05936], Evalue: 0.00095, Aligned region: 185..345
Protein Sequence: 398 a.a.     [Download]
>gi|422938854|ref|YP_007012001.1| intracellular growth locus protein D [Francisella tularensis subsp. holarctica FSC200]
MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIVSFDLDVESLQTGLILIKDLKLYLDE
KNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREKVIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALFRLD
RGRLVPEIYDFPLLTLNHYYLGDIFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAES
NRANSSPKQIFDLIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELH
GKKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGVKLVDVECSMI
NFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|422937995|ref|NC_019551.1|:1102217-1103413 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGTTTCTAGAAAGGATTTATTGGGAAGATGGTTTAAGATTAGATAGCGATATTTTAGATAAGTCAAATC
TATCTGTTTTAGAAAGGTTAAGCACCGCGAGCTATTTGCCAGCTAATCTTAATAAGGGAATCGTTAGCTT
TGATTTAGATGTTGAAAGTTTGCAGACAGGTCTTATCCTTATAAAAGATCTTAAATTGTACTTAGATGAA
AAAAATTTTGTTTTTTATGATAAGTCTTATCCGTTATCTTTACAAATAATGACTGATAAGTTAAGTGATG
AAATCCCCTTATTTCTGAATATCAGAGAGAAAGTAATTGAAAAAAATGGGATTAAATATATCTATAATCA
ATTGTCATTATCATTAGAGCATAGCTATGGTTTTAAACATAGCATCCAAATTGCATTATTTAGGTTAGAT
AGAGGGCGATTAGTACCAGAAATTTATGACTTCCCGCTATTAACTCTTAATCATTATTATTTAGGTGATA
TTTTTGTAAAACTTAATAGGACTGTTTCTGAACTAAAGTCTTTTAATCGCTTTGTTTTTTCAGCTTCAAG
ATCTTATGCGTCAATATTACTTGTATTTTTGATTAATAAATTAGAAAGAGAATTGAAGTTCGCAGAATCT
AATAGGGCAAATAGTTCCCCGAAACAAATATTTGATTTAATTGATGATATTTACAGCTTAATTCAACTTA
ACCTAGATAAAGTTGAAGAGCTTGATAGCATTGAATTTGATTTCCAAAAGCCTTTGACTAAATTAAATCT
ACTTGCTGATAGATTATTAACTCTTTGTGAGTATAGAAAGATTAATAACTTTATCAGATTTGAATTGCAT
GGAAAAAAATATATATGTGAAAGCTTTCCTGAAGAGTTTTTTGTTGCTACTAGATACTATCTTTTCCTTA
AAAGGAAAGCAACAGCTCCAGCCAATGTAAGGTTTGAAAATAAGAATGCTCTGAGAATTACTAGTATAAG
TAGAAATAAGAATATTGTAGCTCTGTCTCTTTCAGGAGTAAAACTGGTTGACGTTGAATGTTCTATGATT
AATTTTACAACTAGATTTGATAATATTGATGCAATATATGAAATTCAAAAAGGTTCTGAGTGGGATTTTA
TATTAGCGGATAGTAGTGCGGTTTTTACGGCTTTTGAAGGTAGTGAGAATTTTGATTTCTTTATAGCCTT
TTCTTAA