SecReT6
Protein ID: 422938855
SecReT6 ID781
T6SS typeii
Gene symbol-
Locus tagFTS_1129
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1103420..1103995 [-]
Producthypothetical protein
NotePdpE
UniProt IDK0E459
KEGG IDfti:FTS_1129, fti:FTS_0101
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|422938855|ref|YP_007012002.1| hypothetical protein FTS_1129 [Francisella tularensis subsp. holarctica FSC200]
MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFLNLNEFCPTNIAACKDENDNNCIYIT
ELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFKNNKYETYYSQVIYNWFVSSE
LYLSFSEGSIFINKDINNSNNYDKGNFLRVNLERIADGWAPPHYEKKITII
 
Nucleotide Sequence: 576 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1103995-1103420 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGAGTAAAAAAATATTTAAATTATTATCAATTTCAATAATATTTAGTATATATCAACAAACATTTAGTA
ATACAATAACAGCTAGTACATTCGAACTAAAAAATAGTTCTAAAAAAAATGCTACTATCTTTCTAAATTT
GAACGAGTTCTGTCCGACTAATATAGCAGCATGCAAAGATGAGAATGACAATAATTGTATTTATATAACT
GAATTAGTTAGAGAACCTCTTAGTCGTATTTACTATTACTTAGCCGTGCCAATTACCAGCAAATCAGTTA
AAGACTTAACAATATTATATAAACATGATAAAGAAGAATCTCCACCAGAAGCAATAAATATATGTTTGAG
TTTATTTAAAAATAATAAGTATGAAACATACTATTCTCAAGTTATATATAATTGGTTTGTATCTTCAGAA
TTATATTTATCATTTAGTGAAGGATCTATTTTTATAAATAAAGATATTAATAATTCTAATAATTATGATA
AAGGTAATTTTCTAAGAGTAAATCTCGAACGTATAGCTGATGGCTGGGCTCCTCCTCATTATGAAAAGAA
AATTACTATAATATAA