SecReT6
Protein ID: 422938856
SecReT6 ID781
T6SS typeii
Gene symbolpdpC2
Locus tagFTS_1130
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1104013..1107999 [-]
ProductPdpC protein
NotePdpC
UniProt IDK0E8C2
KEGG IDfti:FTS_1130, fti:FTS_0102
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1328 a.a.     [Download]
>gi|422938856|ref|YP_007012003.1| PdpC protein [Francisella tularensis subsp. holarctica FSC200]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLRAIHPSKIAMQ
KIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRRLVAKIPDPYWVRADTKENKINITSENKNLEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNDGLL
ENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKILSFTKYKEKYNFLNNDKLREEH
ANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFI
VCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSY
IPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYLEKEEMIMPKSVNNPKDHSIDNGVSLFS
LNLTNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLYMTYLYC
IFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFKALVEKYENSIKPNSKVL
KENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERNCTLLEQYSRKKKAETGLVQDGEKIKV
VNNYNGYAAINQYQRFVSLGIMYDSGAKYSSSHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNK
KSKEKTQSHIVYAKKQNTRYCYGYFNNFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRA
SPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQ
EAANTFIDALYYIRLMQLYYGKTIPFLLISSETVRYSSSETHYYIPTEENFENILKIALNSASKPVIERF
LIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADAYKKNNYKNEINFRAWFESIFHVQN
LSLSPNYIGNNILILSLVEELKPKCSEYKKNMINQQIIAKANELNFYQLIIRLIEISTYHRILTKSIITN
TTSLLYDILNKPEFQTINKSINKLFIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS
 
Nucleotide Sequence: 3987 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1107999-1104013 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGTAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATATATGAGGAGCTTAAGAGCTATTCATCCCTCAAAAATAGCGATGCAA
AAAATTAAATCAATTCGCAATAAAAAAAATTCTTTTATAATTGCCATTTTATCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCACTTTTGGACATAAAACCGTTATTTTTGATTTTAAGAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAAGGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTACTTCTGAAAATAAAAATCTAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGTGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGATGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCTCTAGTCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAAGCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCTCAGGCTTTATGTGAGTTTCTTGATGAAGAGAATATTAACCCGA
AAATTAATCCTATAAATTCTAAAAAGCTATATAAAACCTACAAAGAAAATTATAAAAGCGATTCAGAAAA
AATTTTAAGTTTCACAAAATACAAAGAGAAATATAATTTTTTAAATAATGATAAGCTTAGAGAAGAACAT
GCAAATAAACTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTAT
GTTCAACTAAAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTAT
GCTAGAAACCGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATA
GTATGCTATCTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATA
AGAAAGAAAATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAACTCAAAGCAGAAATATAT
AAAAGATTTTATCGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTAT
ATACCAGTAGCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTT
CTAATCGAATGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTTAGAAAAAGAGGA
AATGATTATGCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAGTGTCTTTATTTAGC
CTTAATCTAACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATC
TTGATTTCAAGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTCGGGATGGC
AACTACAAAAAAAAATGGAGATATCGTAATTGATGAAGATCAAGTGCTATATATGACATACTTATACTGC
ATTTTCATGGCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCCTCAAATACTTATATGTTAA
ATTCTAAAGAGGAAAAGTATCCTATAGCCAATATAGCTAATTTTTTTGCTAGACCTGTATTTAAACTTTC
TAAGGATAAAGAGTTTAAAGCATTAGTTGAAAAGTATGAAAATAGCATAAAACCTAATTCAAAAGTTCTC
AAAGAAAATTATATAAGTAGAGTAACGACGTTATCCGAGGTATATGAAGATATATATAATTTAAATTGCT
TATATAGTTCTCTATCAGAAGGATCCTTGTATAACCTATTATCAACTCATAGTGAAAGAAACTGTACTTT
ATTAGAGCAGTATTCTCGTAAGAAGAAAGCGGAGACAGGATTGGTCCAAGATGGAGAGAAAATAAAAGTC
GTAAACAACTACAATGGCTATGCTGCTATTAATCAATATCAACGTTTTGTATCACTAGGCATAATGTATG
ATAGTGGTGCAAAATACTCCTCTTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTCACCAGA
TAAAGAACAGATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAA
AAGAGCAAAGAAAAAACTCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGAT
ATTTTAACAATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTA
TTTAGTAAACTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGCT
TCACCAGAATTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAAT
ATATTAGTTTTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTA
TGAGATATGGGTCGGACTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAA
GAAGCTGCTAATACTTTTATCGATGCTTTATATTATATTAGATTAATGCAATTATATTATGGCAAAACTA
TACCTTTTTTGTTGATTAGTAGCGAAACTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAAC
AGAAGAAAACTTTGAAAATATACTTAAAATTGCTCTTAATAGTGCCTCAAAACCAGTAATAGAAAGATTC
TTAATTATTCTTAACATATATAATAACACTATTGATGATAATACTTTAATTTTAATACGATGCCGTTTAA
CAATAATATTATTTGAACATGAAGAGCAGAAACTCAAATTAAAAGCTTTACAAAAATATGCTGACGCTTA
TAAAAAAAATAATTATAAAAACGAAATTAATTTTAGAGCTTGGTTTGAATCTATATTTCATGTTCAAAAC
TTATCCTTATCTCCTAATTATATTGGCAATAATATTTTAATCTTGAGTTTAGTTGAAGAATTAAAACCAA
AATGTAGTGAATATAAAAAAAACATGATTAACCAACAAATTATAGCTAAAGCAAACGAGTTAAACTTTTA
TCAACTTATAATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAATCATAACTAAT
ACAACCTCGTTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATCAATAAATAAGC
TATTTATTTATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTAT
TGAAAAAACCTATAAGAAAATAAATAGCTTATATAAATCAGACTTTTTTAAAAAAATATCATCATAG