SecReT6
Protein ID: 422938857
SecReT6 ID781
T6SS typeii
Gene symbol-
Locus tagFTS_1131
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1108039..1108812 [-]
Producthypothetical protein
NoteIglJ
UniProt IDK0E8Y7
KEGG IDfti:FTS_1131, fti:FTS_0103
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|422938857|ref|YP_007012004.1| hypothetical protein FTS_1131 [Francisella tularensis subsp. holarctica FSC200]
MKTILKIFLTYKQYWKILNMQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDN
KETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCA
PKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVYIINIKIYLISK
NQYVINKIKTQIKKIEEKITKLPFKIELEISIENNKKNQIYLSYFNL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1108812-1108039 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGAAGACTATTTTGAAGATCTTTTTGACATATAAACAATATTGGAAGATATTAAATATGCAACACATCA
ATAATATCAATAAAAATATCTCTCTAAATAACTTTGTAAGTCTTCTAAAAAGTCAGAAATATTCTTTGAA
AAGAATAAATTTCATACCGGTAATGATTAATAAAACCTCATCTCCTACCATATTAGATATTTATGATAAT
AAAGAAACTCTAAATGTAAAAATAAATATCTTTAAAATCAAACCATTCACTAAATTACAGAGTATTTATC
AAGAATATATCCAAAACAATAATGACTTGGCTATTGAAATACTTGGATACGGATTAAAAGTGCTGCTAAA
GTTATACATTTTAGATACTAAAGCACTGCACAAATTCACAACAAAAAATAGTTATTATATTCAATGTGCT
CCCAAATACACTATAGATAACATAATAAACAATATCTATAAATTACTCTCGGAAGACTATTGCACAGTAA
TAGATTATAAAGAAAAACTAATCAATATAAAGAGAAAACAAATAGTAGTAGGAGATTCTTACGTTGGAAA
ATCTTTCTTGGGGGCATATATTCCTTCATATGTTTATATTATAAACATTAAGATATATCTCATTAGTAAA
AATCAATATGTCATAAATAAAATCAAAACTCAAATTAAAAAAATTGAGGAAAAAATTACAAAGCTCCCAT
TTAAGATAGAACTTGAAATATCAATTGAAAATAATAAAAAAAATCAGATATACCTAAGTTATTTTAATTT
ATGA