SecReT6
Protein ID: 422938859
SecReT6 ID781
T6SS typeii
Gene symbol-
Locus tagFTS_1133
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1109951..1110574 [-]
Producthypothetical protein
NoteDotU
UniProt IDK0E740
KEGG IDfti:FTS_0105, fti:FTS_1133
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-10, Aligned region: 28..205
Protein Sequence: 207 a.a.     [Download]
>gi|422938859|ref|YP_007012006.1| hypothetical protein FTS_1133 [Francisella tularensis subsp. holarctica FSC200]
MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVD
EKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEICYQTISLILHNDFYGKYYDNI
YNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW
 
Nucleotide Sequence: 624 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1110574-1109951 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGAAAGACTTTAAAGAGATAGAAATTATTCTAGATATTATAAAAACTACAAGAGAAATTATAGAAGATA
ATGATAATGATAATGAGAAAATATCATACCATCGTAATAATATAAGAAAAAGTATTTTCTTCCTACAAGA
AGAGCTCTTAGAAAAATATAGTGAAACTGTCTGTAAATATATAGTTTTTCCGTTACTTGCATATGTTGAT
GAAAAATTGATGCTACTTAGGGAAAAGTCAGCAAGCAATATTTCTTGGAGTCTATTACAATTAGAATATT
ATGATAGAAAAGATGGCGGTGAATATGTTTTTGAGATAACTGATAATATTTTATCAGAGAATATCTATCC
AGAAATTTGCTACCAGACAATATCACTTATCCTACACAATGACTTCTATGGCAAATACTATGACAATATA
TATAACCATAGCTTTCTTGCTTATAAGAAAGAAATTGATAAGCATATAGAAAATTCGACAATTGATTCGG
TTAATTTTATTGATATACCCGTTAATAGCCCCCCACTGTCAAGAAAATATAGTAAGACGCTTAAATTCTT
ATTAAGAATAGGCGTTCCTTTAGGACTGTTTCTTTTAAGCTTACTAATTTTATTAAGCTGGTAA