SecReT6
Protein ID: 422938861
SecReT6 ID781
T6SS typeii
Gene symbol-
Locus tagFTS_1135
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1112030..1112551 [-]
Producthypothetical protein
NoteIglG
UniProt IDK0E8I7
KEGG IDfti:FTS_1135, fti:FTS_0107
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|422938861|ref|YP_007012008.1| hypothetical protein FTS_1135 [Francisella tularensis subsp. holarctica FSC200]
MLNIINDSLKRLKEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1112551-1112030 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGAAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG