SecReT6
Protein ID: 422938862
SecReT6 ID781
T6SS typeii
Gene symbol-
Locus tagFTS_1137
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1112619..1114283 [-]
Producthypothetical protein
NoteIglF
UniProt IDK0E8Z1
KEGG IDfti:FTS_0109, fti:FTS_1137
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 554 a.a.     [Download]
>gi|422938862|ref|YP_007012009.1| hypothetical protein FTS_1137 [Francisella tularensis subsp. holarctica FSC200]
MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKADIYNLTYVIEDVRYSTNLIL
SDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNLKVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLD
YINNHSISAYDDSLVKLYVKTIQNPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAY
LIRNGLYKTDRLLASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIAFIDLQ
IFAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKNISNIMFDEETLYKKIHIKNQLYKNLFLNN
HNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVNNNLKLIYPFLEFEKYFNQVTLEVSKKSQF
NQEKLEKNILNIIRIYPLLNQNYQLLKNMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIRTLTSND
HKDINIHKSLVKLNKNICNAKHKNAAETAKELTMVLLSKSYYMNPTLIGVYNLPPISNSFFFGA
 
Nucleotide Sequence: 1665 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1114283-1112619 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGAATAATAATATTGATAAATGGTTTGAGAATTTATTTAGCAATATCCATTTATATTATAAACAAGAGC
AATCTTATAAAATAAGTAAGCTTAATGAGTGCATCACTAACGTAATCAAATTTATAAATATAAAAGATTA
TAGAAAAGCTGACATCTATAATCTGACCTATGTTATTGAAGATGTAAGATACTCAACGAATCTAATTTTA
TCTGACTCTGCAATTAAATTTAATGATTTAATATTAAAAAAATTAGATAACCTCTTAGATTGTACTGATA
TTAACTATTTTACTAGCCTTATGAAGAATTTAAAGGTTCTTTTAGAAAAGTATAAACTAGTAATAGAGAA
AGATATATCGAATAGAATAGAACTTATAAAAACTAAGCAGATCGATAAACTAGAATCTATATTTTTAGAC
TATATAAACAACCATAGTATCAGCGCTTATGATGATAGTCTTGTAAAATTATATGTAAAAACTATACAAA
ATCCCAATTCCATTGAGGCTATAGATGAGTATAAATCATATTTCGATACGCTCAAAATATTTATAAAAGA
TCATAAAAATATAGTTAGTTTTATTCCCTTTAGAAAAAATCCTATTTTAAGCTTATTGAAATTAGCTTAT
TTAATTAGAAATGGTTTATATAAAACAGATCGTCTTTTAGCTAGCGATATTATTCTTTTAAGAGCTTTAT
ATTCTATAAATAAAGATACATATAAATTAAGTCTTATAAATGAAAAAACAGATACTAACCTATCAATAGT
TTCGCTGACGTCACTACAAGCTAAGCCCTCAGAAAACTTAAAAAAAACTATTGCTTTTATAGATTTACAG
ATATTTGCTATATCTCAGTATTTTGATGATTTCCCTTTACAGGATATTTTTTTTCAAAAAAAATCACAAA
TAGACATTTTCAAGTCAGAATCACTAGAACAACTTATTTTCAGTTTAAAAAATATTTCAAATATAATGTT
TGATGAAGAAACACTATATAAAAAAATCCATATAAAAAATCAACTCTACAAAAACCTTTTTTTAAATAAT
CACAATAGTTTGATAGAAGATATTATAGAAAAATCTCCAGCAAACTTATTAACAAAGTTAGCTAATAAAT
ACTTCCAAATACTGCTAGACATAGCAACAATAATAAATATTCAATTAGTAAATAATAATTTAAAGCTTAT
TTATCCTTTCTTAGAGTTTGAAAAATATTTTAATCAAGTAACTTTAGAAGTATCAAAAAAATCACAGTTT
AATCAAGAAAAGCTAGAAAAGAATATTCTAAATATTATCAGGATATATCCTTTACTAAATCAAAACTACC
AATTATTAAAGAATATGGAACAAAAAATTATTGATGATAAAAATAGTATAGAATCAAACGATATATATAA
GCTTAGTGTTTTTGTAAATAGCAAAAGTTTTTCTACCTATAAAGAAATCAGAACCTTAACCTCAAATGAC
CATAAAGATATTAACATACACAAATCTTTAGTAAAACTGAACAAAAATATTTGTAATGCCAAACATAAGA
ATGCCGCTGAAACAGCTAAAGAGCTAACGATGGTTCTTTTAAGTAAATCTTACTATATGAATCCAACTTT
GATAGGAGTATATAATCTACCGCCAATTTCAAATAGTTTTTTTTTTGGTGCTTAA