SecReT6
Protein ID: 422938864
SecReT6 ID781
T6SS typeii
Gene symbol-
Locus tagFTS_1139
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1114795..1115172 [-]
Producthypothetical protein
NoteIglE
UniProt IDK0E632
KEGG IDfti:FTS_0111, fti:FTS_1139
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|422938864|ref|YP_007012011.1| hypothetical protein FTS_1139 [Francisella tularensis subsp. holarctica FSC200]
MYNKLLKNLCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLN
LKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1115172-1114795 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGTACAATAAATTATTGAAAAATCTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTA
GTGATGGTTTGTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAA
TATTTTCTACTCAGATAACTATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTTAAAACAGGAAAGAATGAATTTCCATTAGATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTC
CTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAGTTCAGATTCTGTAAATAAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGATTAA