SecReT6
Protein ID: 422938865
SecReT6 ID781
T6SS typeii
Gene symbolpdpB2
Locus tagFTS_1140
StrainFrancisella tularensis subsp. holarctica FSC200
Repliconchromosome [GenBank: NC_019551] [Browse all T6SS(s) in this replicon]
Location [Strand]1115162..1118443 [-]
ProductPdpB protein
NotePdpB
UniProt IDK0E465
KEGG IDfti:FTS_0112, fti:FTS_1140
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.002, Aligned region: 847..939
Protein Sequence: 1093 a.a.     [Download]
>gi|422938865|ref|YP_007012012.1| PdpB protein [Francisella tularensis subsp. holarctica FSC200]
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKVKNNLSELYIF
YGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISD
DYYHENIKISEIYKELLKLRLKNFIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILS
SKDDVNNKYNNVKILNQIRKLLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSFPKSIIINLIS
LLFSFIFIVNIFQEINIKKKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIKYHFIYKQYAD
TLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVVKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGKDSKSYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYKCATDNAILDL
NDNYIIPIEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKS
LEKNAKDVADDGKKQTSSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIY
SKEYIKDNIDPTNKKFNRLVNNLKNNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNI
SNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQNNTNDQND
KSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINTIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNG
YIYSGFIEQLSPLLFYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKINPKAIKFDITPIPNK
DNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKDAN
CDQNNICTWIIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ
 
Nucleotide Sequence: 3282 bp     [Download]
>gi|422937995|ref|NC_019551.1|:c1118443-1115162 Francisella tularensis subsp. holarctica FSC200 chromosome, complete genome
ATGAATTTTATTAAAAATCATCAAATATTAATAATTTCACTAACTATAGCAATAATTGTTTTATCAGTAC
TTGGTATTTTTATGATTAAAAAATGGCTTAAAACATCAAGAAATCCTAACAAAAAATCTGCCTCAAAGAC
CATAAAAAATGCGAAATCATTGATCAAAAAGAATAAAGTAAAAAACAACTTAAGTGAATTGTATATTTTC
TATGGGGACTATCTGGCAGCTAAAGATTATATAACAAAGATAAAACCTCAAGCTCAAATCATTGATAATA
ATGAACTCCCTTTAATAGCTATTGATAAAAACAATACATCTCTCGTATTTGCAAATAATGAATTTTCGTA
CCTATATAAGTTAAAAAAGAAACTAAATCTACAATTTTATAAGCTTAACTTTTGCTTCGATATATCCGAT
GATTACTATCATGAAAATATCAAAATTAGTGAAATCTATAAAGAACTATTAAAATTAAGATTAAAAAACT
TCATAATATCTTTTTACACCTTATCTGAGCATACTAGAAGCTATAATAATGCAATTGATAAAAAATCAAT
ATTTAAATTAACTTCTGATGCGGATACAAATCATAAAGCTGAAGAGGAAATATTATCAAAAATTCTTAGC
TCTAAAGATGATGTTAATAATAAATACAATAATGTTAAGATATTAAATCAAATAAGAAAGTTGCTAAAAA
ACATCCACCCTCAATTAAAATCTATAAATAAAGAAACATTCTTTAATTTTGGGCTAAACACACCAGATAA
TATCATAGCAAAGAAAGATACAATATTTTTTAGCAGCTTTCCAAAAAGTATTATCATAAACTTAATATCT
TTGTTATTTAGTTTTATATTTATCGTTAATATTTTTCAAGAAATTAATATTAAAAAAAAATTCTCTATAC
AAGAACTTAATCAACTACATGAAAGCGACTCTAATAAAATAATAGAAGAAACTAGAAAAAAAATTGATGA
GGCTATACTTCTAGATATCCTATATCCGAAATCGATAAAATATCATTTCATATACAAACAATATGCTGAT
ACTCTCCTAAAGAATGTAATCTTACCAAAATATAATGATACATATGACTTATCAATGATTACATCATTTT
TAATATTTTTTGAGTATTTGGATAACAAAATTATTAACCAACATACGAATAGAATACTTAAAATAATAAG
CAGTATCACCAACCTATCTGAAAAGCAGCTAGATATCGTGGTCAAGTATACGACCCCAAGTATAAGAACT
GAAATGATTAAGTCAGCCATCAACAGAGCAAATAAACTTTATACAAATCGTTTAATAGTTGTAGGTAAAG
ACTCCAAAAGTTACTTAAGTACTAAAGGATTTAATGCTGAATACTTAGGGATTTCAAATACTAAAAGAGC
GAAGGTCATAAATAATATTTATATACAATACCTATATAAATGTGCTACAGATAATGCAATTTTAGATTTA
AACGATAACTACATAATACCAATAGAAGTAAATAATATCTTCAAGATGTATCAAGAGCAATTTGACACAT
CCTCTAAAAAGCTATGTAACTCATCATATATTAACTCTATTACAAAGAGCGTTTCTTTGATACTTAATCA
AGAGGAAAATAAAAGAAAATTTGAAAGCTTCAGTGATATGCTAGACCATATCTATTATTTAGTAAAATCA
TTAGAAAAAAATGCTAAAGATGTCGCAGATGATGGTAAAAAACAAACTAGCTCGATAACAGTATCGCTTA
TAAATTACGTTATAAATAGTGTTGTCAACCCTACTTATAATAAAAATGAGCTCCCACTAATAAGTCCAGT
AAGTAAAAACCTATATATGGAGTTTGCTCCTAATTTCTATAGTAAAAGAATACTTATCTCTCCAATATAC
TCAAAAGAATATATTAAAGATAATATAGATCCTACAAATAAAAAGTTTAATAGACTCGTCAATAATCTAA
AGAATAACTTCAATATAGAACCCGACTTTATGATTGCTATCTATAAAAGCTCTATAAATAACTACATTGA
GAAATATATAGGATCCTATAATAAGATGATTGATAGCCTTAATAATGACTCTGAATTTAACAAAAATATA
TCTAACAAGGGTGCTCTTAAATTATATTTGCTAGCAATGTCATCAAAGGATTCTTCCTTTAATAGCCTAA
TAGAGTTTTATAGCACTAATACAGACCTAATAACTAATGAATCCGAAACCAATTCATCTAAAAAGATAAA
TAAGCTTCAACATTTTTATGGAGAAATAACTAAATTAAACAAACAAAATAATACTAATGATCAAAATGAT
AAGTCATTGTGGGCGCCTATAGATAACTACTTTAAAGAAAACGATAAATATCTTGAGTCTAAGAGTTATG
CCGACTATAAAAACATATTTAAACAGTTAAATAATCTAATAATAGAACAAGGCTATTCAAGTACATATAA
AAATATCAAACAAGGATATGAACCACTACAAAAAGTTTACTCTGAACTTTCTAAGATAAATAATCATCAA
GGTAATAATAACTTATATAAACTGTTGAAGAAACATCTAGATATTGCCATTAATACTATAAAAACTATCG
CCATACAAGATGCTATAACTAAACTTGATAATACTGTCAATATTGAGTACGAATACATAAATAATCAATT
CCCTTTTAATAAGGATAGTAACTCGGCTGCAACAAATGAAGCTATAACCAAAGACTTTGATAACAATGGT
TATATATACTCTGGATTTATAGAGCAACTATCTCCACTACTTTTTTATAATAAAACTGATGATAGATGGG
AAAGTAAAGATTTTTCAAAACCTGAGGAAATAGACTATCTAAATAAATTCAATAAGGTATATCTTTTAAA
TAAGCTACTATGGGATGATAAAATAAATCCAAAAGCTATAAAATTTGATATAACTCCTATACCAAACAAA
GATAATGATTATACATTTTTTAGCATAATCCTCGATAAGCAAAACTATGTAAACTCATTAAACATAAAAT
ATTCAGATAGTATTGAAGTTTTGTACAACTGGAATTCACTTGAGTCAACAACTATTACCATAAAATTTGA
GGATGGTAGTAATGAGCAAATAAGCTATCAAGGAAAATGGTCTATATTAAAAGCAATTAAAGACGCAAAT
TGTGATCAAAACAATATTTGTACCTGGATAATCAAGCACAAAGGTAAAAAATATCCTTTAAGCTTCAAAA
TAGAATCAAAATTCTTACAAGTATTAGGATGGCAAAAACAAGGAGAAGTCAATGTACAATAA