SecReT6
Protein ID: 423049862
SecReT6 ID778
T6SS typeii
Gene symbol-
Locus tagF92_00665
StrainFrancisella tularensis subsp. holarctica F92
Repliconchromosome [GenBank: NC_019537] [Browse all T6SS(s) in this replicon]
Location [Strand]115150..115671 [-]
Producthypothetical protein
NoteIglG
UniProt IDK7WVK9
KEGG IDfts:F92_00665, fts:F92_06445
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|423049862|ref|YP_007008296.1| hypothetical protein F92_00665 [Francisella tularensis subsp. holarctica F92]
MLNIINDSLKRLKEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|423049750|ref|NC_019537.1|:c115671-115150 Francisella tularensis subsp. holarctica F92 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGAAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG