SecReT6
Protein ID: 426409972
SecReT6 ID713
T6SS typei2
Gene symbol-
Locus tagPputUW4_03071
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3606319..3607476 [-]
Producttype VI secretion system OmpA/MotB domain-containing protein
NoteTssA
UniProt IDK9NJN1
KEGG IDppuu:PputUW4_03071
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.80E-16, Aligned region: 38..96
ImpA-rel_N [PF06812], Evalue: 6.80E-16, Aligned region: 104..112
OmpA [PF00691], Evalue: 3.70E-15, Aligned region: 264..360
Protein Sequence: 385 a.a.     [Download]
>gi|426409972|ref|YP_007030071.1| type VI secretion system OmpA/MotB domain-containing protein [Pseudomonas sp. UW4]
MLFEMRIRLGGDPRGHGEFIALREELAKLSHPACPDVDWARVEQWCLALFEHNGADLQTAAAFALARSQR
HGVEGMTQGVTLIETLCGQWAACWPPMASVRLDILAWLCVQWQALLRNLAPGTQHFPELLQLDSGLVRLQ
QRLELQAQAPVVALHALRQQIESLIRRMQRSSVVVGTLSPPAREPAPAVMMPVVILPPNPLPMPEMPPAK
RPLARWLCAAAVVTSLVSGAWWLGSTGVAEQRLAHLLQPPPTIVEPVRLDSLSLFDAGSAELKPGSTKIL
IGALVDIKAQPGWLIVIGGHTDGRGNPQDNLLLSHARASAVRDWMQRMGDIPDSCFAVQGFAASQPVTSN
DSESGRAANRRVEISLLPQAGACGQETPEERAAQT
 
Nucleotide Sequence: 1158 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3607476-3606319 Pseudomonas sp. UW4 chromosome, complete genome
GTGCTATTTGAAATGCGTATTCGACTGGGCGGTGATCCGCGCGGTCATGGTGAGTTTATTGCGCTGCGCG
AAGAGCTGGCGAAGTTGAGTCATCCGGCCTGTCCCGATGTAGATTGGGCGAGAGTGGAGCAGTGGTGCCT
GGCACTGTTCGAACACAACGGCGCAGACCTGCAGACGGCCGCCGCGTTTGCCCTGGCGCGCAGCCAGCGG
CATGGCGTGGAAGGCATGACTCAGGGGGTGACGCTGATCGAAACCCTGTGCGGCCAGTGGGCGGCCTGTT
GGCCACCCATGGCGTCGGTGCGCCTGGATATCCTCGCTTGGCTGTGCGTGCAGTGGCAGGCGTTGTTGCG
CAATCTGGCGCCTGGAACACAACACTTCCCCGAGTTGCTTCAACTGGACAGCGGGCTGGTGCGTTTGCAG
CAGCGCCTGGAGCTGCAGGCACAAGCGCCGGTGGTGGCCCTGCATGCCTTGCGCCAGCAGATCGAGAGCC
TGATCCGGCGCATGCAGCGCAGCAGCGTTGTGGTCGGCACGCTATCGCCGCCTGCAAGGGAGCCGGCGCC
GGCTGTGATGATGCCCGTGGTGATATTGCCGCCCAACCCCTTGCCCATGCCTGAAATGCCGCCGGCGAAG
CGTCCCCTGGCCCGGTGGCTTTGCGCTGCAGCCGTTGTGACGAGCCTGGTCAGTGGAGCCTGGTGGCTGG
GCTCGACCGGCGTCGCCGAGCAACGCCTGGCGCATCTATTGCAGCCGCCGCCGACTATTGTCGAGCCTGT
GCGCCTGGACAGCCTGTCGCTGTTCGACGCCGGTAGCGCCGAGCTCAAGCCGGGCTCGACCAAGATCCTG
ATCGGCGCCCTGGTCGACATCAAGGCCCAACCCGGTTGGCTGATCGTCATTGGCGGACATACCGATGGCC
GTGGAAACCCGCAGGACAATCTCCTGCTCTCCCACGCGCGAGCCTCTGCCGTACGTGACTGGATGCAACG
CATGGGCGACATCCCCGACAGTTGCTTTGCGGTCCAGGGCTTTGCCGCCAGCCAGCCGGTCACCAGCAAT
GACAGCGAGTCCGGGCGCGCGGCCAACCGACGCGTCGAAATCAGCCTGCTGCCCCAGGCGGGCGCCTGTG
GCCAGGAAACGCCGGAGGAGCGTGCTGCGCAAACCTGA