SecReT6
Protein ID: 426409973
SecReT6 ID713
T6SS typei2
Gene symboltssE
Locus tagPputUW4_03072
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3607502..3607942 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDK9NKW4
KEGG IDppuu:PputUW4_03072
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.90E-15, Aligned region: 28..117
Protein Sequence: 146 a.a.     [Download]
>gi|426409973|ref|YP_007030072.1| type VI secretion system lysozyme-like protein [Pseudomonas sp. UW4]
MSDLNPSLYETLLQNFDGDLDLYQVNEEDQHTLSVLDNLQRILNSRAGTLAHLPDYGLPDMGQILQGLPG
SAHVLMRAMQDTLSKYEPRLATLHIELLEQALPGHLDYSLDVLLKSGRQVTFGTTLAAEGKVLVRHLKRQ
QWLSKS
 
Nucleotide Sequence: 441 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3607942-3607502 Pseudomonas sp. UW4 chromosome, complete genome
ATGTCTGACCTCAATCCATCGCTTTACGAAACTCTGCTGCAGAACTTCGACGGTGACCTGGACCTGTATC
AAGTCAATGAAGAGGACCAGCACACGCTGTCGGTACTGGACAACCTGCAACGCATCCTCAACAGCCGGGC
CGGAACACTCGCGCACCTGCCCGATTACGGTCTTCCCGACATGGGCCAGATCCTCCAGGGCCTACCGGGC
TCGGCGCACGTGTTGATGAGAGCCATGCAGGACACCCTGAGCAAGTACGAACCGCGTCTGGCGACCTTGC
ACATCGAGTTGCTCGAGCAAGCTTTGCCAGGTCATCTGGACTACAGCCTCGACGTGCTGCTCAAAAGCGG
CCGGCAGGTGACCTTCGGTACCACACTGGCAGCGGAGGGCAAAGTCCTGGTGCGCCATCTGAAACGACAG
CAATGGCTGTCGAAATCCTGA