SecReT6
Protein ID: 426409974
SecReT6 ID713
T6SS typei2
Gene symboltssJ
Locus tagPputUW4_03073
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3607945..3608481 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDK9NM77
KEGG IDppuu:PputUW4_03073
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-34, Aligned region: 15..169
Protein Sequence: 178 a.a.     [Download]
>gi|426409974|ref|YP_007030073.1| type VI secretion lipoprotein [Pseudomonas sp. UW4]
MSRTVGNSLILTTLAVVLAGCGVTQTVSEGTASATRSIFYKQVKDLRLDFSARTAINTDVADMNAMSVPT
LVRVYQLSDSKALQRASYDSLLGGDEQALAGNLLDTRALVIKPGEGAKLDVPLDKDARFVTVVALFRNPD
VQMNTWRLTLNRDDLDPDRARVIELGDNQLTLRALARD
 
Nucleotide Sequence: 537 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3608481-3607945 Pseudomonas sp. UW4 chromosome, complete genome
ATGTCGCGTACCGTTGGTAATTCATTGATCCTGACCACGCTGGCGGTAGTGCTCGCCGGCTGTGGTGTCA
CTCAGACTGTCTCGGAAGGCACGGCATCAGCCACCCGCTCGATTTTCTACAAACAGGTCAAAGACTTGCG
CCTGGATTTCAGTGCCCGCACGGCCATCAACACTGATGTTGCGGACATGAATGCGATGTCGGTCCCGACG
CTGGTGCGGGTCTATCAACTGAGCGATAGCAAGGCGCTGCAGAGGGCTTCCTACGACAGCCTGCTCGGTG
GCGACGAGCAGGCGCTGGCCGGCAATTTGCTCGATACCCGGGCGCTGGTGATCAAGCCTGGCGAGGGCGC
GAAACTGGATGTGCCGCTGGACAAGGACGCGCGGTTCGTCACGGTGGTCGCGCTGTTTCGTAACCCCGAT
GTGCAGATGAATACCTGGCGCCTGACCTTGAACCGCGACGATCTCGACCCGGACCGGGCACGGGTCATCG
AGCTGGGGGACAACCAATTGACCCTGCGCGCATTGGCCCGGGACTGA