SecReT6
Protein ID: 426409975
SecReT6 ID713
T6SS typei2
Gene symbol-
Locus tagPputUW4_03074
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3608462..3609559 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDK9NKJ6
KEGG IDppuu:PputUW4_03074
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-84, Aligned region: 26..326
Protein Sequence: 365 a.a.     [Download]
>gi|426409975|ref|YP_007030074.1| type VI secretion protein [Pseudomonas sp. UW4]
MEREPQSAYSRLKACGLLEVLEGRVAEASLYRFCQLLEQALPGHPPLGSTSHPADDPVRFRPDPGMGFPA
GELKCIEIDDRQPLRPATVRTRLLGLYGVDSPLPTAFVDDIAQRRDGHEALEAFLDIFNHRIFTQFYRIW
RKYSYPATFEAGGSDATSQCLLGLVGLGIPGTAKRIATPVSRFLALLSVMRMPTRNAEGITALVSLLAPE
TRARITPHWPQRIPLAHPASLSASRPVSLSQGTPLGSNGFDANSQLHLALFTRDRDEARGWLPDGQLYND
LLVLLRVYLGWRCTARLQLSLPVRSLPQPVLGRAPIRLGMTGMLGSGSDTWQGAEHDTITINLGRYQGLS
KNPRNREAQHVAYRW
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3609559-3608462 Pseudomonas sp. UW4 chromosome, complete genome
ATGGAACGAGAACCACAGTCAGCGTATTCCCGGCTGAAAGCCTGCGGATTGCTCGAGGTGCTGGAGGGGC
GGGTGGCCGAGGCCAGTCTGTATCGGTTCTGCCAGCTGCTGGAGCAAGCCCTGCCAGGCCATCCGCCGCT
GGGCAGCACCAGCCATCCGGCAGACGACCCGGTACGGTTTCGCCCGGACCCCGGCATGGGCTTTCCCGCC
GGTGAGCTGAAGTGCATCGAGATCGATGACCGGCAGCCGCTGCGTCCGGCGACGGTGCGTACGCGGCTGT
TGGGCTTGTACGGCGTGGATTCGCCATTGCCGACGGCTTTTGTCGACGACATTGCCCAGCGCCGCGACGG
GCATGAGGCGCTTGAGGCGTTTCTGGATATTTTCAACCACCGGATCTTCACCCAGTTCTATCGGATCTGG
CGCAAGTATTCCTACCCGGCCACCTTCGAAGCCGGCGGCAGTGATGCGACGTCGCAGTGTCTGCTGGGTC
TGGTCGGTCTTGGCATTCCCGGCACGGCCAAGCGCATTGCCACGCCGGTTTCGCGGTTTCTCGCGCTGCT
TAGTGTGATGCGCATGCCCACCCGCAACGCCGAGGGCATCACCGCTCTGGTGTCGCTGCTCGCTCCAGAG
ACCCGGGCCAGGATCACGCCGCACTGGCCGCAGAGAATCCCCCTGGCCCACCCGGCGAGTCTGTCCGCGA
GTCGTCCGGTCAGCCTGTCCCAGGGAACGCCGCTGGGGAGCAACGGATTCGACGCCAACAGCCAGCTGCA
CTTGGCGCTGTTCACCAGGGACCGGGACGAAGCACGGGGCTGGTTGCCCGATGGCCAGTTGTATAACGAT
CTGCTGGTGTTGCTGCGGGTCTACCTGGGCTGGCGCTGCACCGCCAGGCTGCAGTTGTCGCTGCCGGTGC
GCAGCTTGCCGCAACCGGTGCTGGGGCGGGCGCCGATCCGCCTGGGTATGACCGGCATGTTGGGTTCGGG
CAGTGACACCTGGCAGGGCGCGGAACACGACACCATCACCATCAATCTGGGCCGCTACCAGGGCCTGTCG
AAAAACCCTCGGAACAGGGAAGCACAGCATGTCGCGTACCGTTGGTAA