SecReT6
Protein ID: 426409976
SecReT6 ID713
T6SS typei2
Gene symbol-
Locus tagPputUW4_03075
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3609523..3611286 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDK9NM33
KEGG IDppuu:PputUW4_03075
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.80E-184, Aligned region: 6..584
Protein Sequence: 587 a.a.     [Download]
>gi|426409976|ref|YP_007030075.1| type VI secretion protein [Pseudomonas sp. UW4]
MDNLTLRYYDAEMRYLREAGQEFAQAFPDRAAQLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFQVELAQLRRSELIAAGQEVLSQPIGPQRTVCRYTTTQDLRLQPIE
LQSLRLAHEPDGRSLLRLRFACATAIDWSQIDLSRVPMYLNADAPLASALHQALTLHAQALYVRLPGETQ
RVALAGHFAPKGFADEDRLWPKGDSAFSGYQLLLEYFTFREKFMFVTLHGLEQVSITPGMPWFELEVVLR
ESWPQAFNLSAEHLRLHAVPVINLFTLEADPMPLDPLQTDYLLRPMRLQDGHTEIYSVDRVTASKNTERL
DYVPFSSFRHKGGMLRDEAPERYFHTRLKRGAIGLHDTWLILGGDGFDQDRLQGSQSLSLQLTGTHGLLP
RKALQSTLLDGLVNTAVSGLRVRNLSAPTLPCYPPNRDRFHWRVLSHLGSNFLPMLDNAEVLRGTLALYD
WTGSELNRRRLAAIVEVRHHLVQRFEKGFLLRGVDIEVTLDAHGFCGEGDISLFGEMLHRFFALYADIHL
FNQLTLILQPTGKCLRWNENHSQRIPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3611286-3609523 Pseudomonas sp. UW4 chromosome, complete genome
ATGGACAATCTGACACTGCGTTATTACGACGCCGAGATGCGCTACCTGCGCGAAGCCGGGCAGGAGTTTG
CGCAAGCGTTTCCCGACCGCGCGGCGCAGTTGAACCTGGACAAACCCGGCGCCCGCGATCCCTATGTGGA
GCGTCTGTTCGAGGGCTTCGCTTTCTTGATGGGGCGCCTGCGCGAAAAGCTCGACGACGACTTGCCGGAG
TTGACCGAAGGCCTGGTCAGCCTGTTGTGGCCCCATTACCTGCGCACCATTCCCTCGCTGTCGATCGTCG
AGTTCCAGGTGGAACTGGCACAGCTCAGGCGCAGCGAGCTGATCGCCGCCGGGCAGGAGGTGCTCTCGCA
ACCCATCGGGCCGCAGCGAACCGTATGCCGTTACACCACCACCCAGGACCTGCGGCTGCAACCCATCGAA
TTGCAATCCTTGCGCCTGGCCCATGAGCCCGACGGCCGCTCGCTGCTGCGCCTGCGGTTTGCCTGCGCAA
CGGCGATCGACTGGAGCCAGATCGACCTCAGCCGCGTGCCGATGTACCTGAACGCCGATGCCCCCCTGGC
CAGCGCGCTGCATCAGGCCCTGACCCTGCATGCCCAGGCGTTGTATGTGCGCCTGCCGGGTGAGACGCAA
CGAGTTGCACTGGCAGGTCATTTCGCGCCCAAGGGCTTTGCCGACGAGGACCGTTTGTGGCCAAAGGGCG
ACAGCGCGTTCAGTGGGTATCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTCATGTTCGTGAC
GCTCCATGGCCTGGAACAGGTGAGCATCACACCGGGCATGCCCTGGTTCGAGCTGGAGGTGGTCCTGCGC
GAGTCGTGGCCGCAGGCATTCAACCTGAGCGCCGAACACCTTCGCCTGCATGCGGTACCGGTGATCAATC
TGTTCACCCTGGAAGCCGATCCGATGCCGCTGGACCCATTGCAAACCGACTACCTGTTGCGTCCCATGCG
CCTGCAGGACGGTCACACGGAAATTTACTCGGTGGACCGGGTCACCGCATCGAAGAACACCGAGCGTCTG
GACTATGTGCCGTTCAGCAGTTTTCGTCACAAGGGCGGAATGTTGCGCGACGAGGCGCCCGAGCGTTACT
TCCATACCCGCCTCAAGCGAGGCGCCATTGGCCTGCACGATACCTGGCTGATTCTCGGGGGCGACGGCTT
CGATCAGGATCGCTTGCAGGGCAGCCAGAGCCTGTCCCTGCAACTGACCGGGACCCACGGCCTGCTGCCA
CGCAAGGCGCTGCAAAGCACCCTGCTTGATGGGCTGGTCAACACCGCCGTGAGCGGCTTGCGCGTGCGCA
ATCTCAGCGCCCCGACCTTGCCGTGTTATCCGCCGAACCGCGATCGTTTCCACTGGCGCGTACTCAGCCA
CCTGGGCTCCAACTTCCTGCCGATGCTCGATAACGCCGAAGTGCTGCGCGGCACCCTGGCGCTGTACGAC
TGGACCGGCAGCGAACTGAACCGCCGTCGCCTGGCGGCCATCGTCGAAGTCAGGCACCACCTGGTGCAGC
GGTTCGAAAAGGGCTTTCTGCTGCGCGGCGTGGACATCGAAGTGACCCTCGACGCCCATGGTTTTTGCGG
CGAGGGCGACATCAGCCTGTTCGGCGAAATGCTCCATCGCTTCTTCGCGCTGTATGCCGACATTCACCTG
TTCAACCAGCTCACGCTGATCCTTCAACCTACTGGAAAGTGCCTGCGATGGAACGAGAACCACAGTCAGC
GTATTCCCGGCTGA