SecReT6
Protein ID: 426409977
SecReT6 ID713
T6SS typei2
Gene symbol-
Locus tagPputUW4_03076
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3611314..3612900 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDK9NJN4
KEGG IDppuu:PputUW4_03076
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.00E-22, Aligned region: 65..124
ImpA-rel_N [PF06812], Evalue: 6.00E-22, Aligned region: 156..181
Protein Sequence: 528 a.a.     [Download]
>gi|426409977|ref|YP_007030076.1| type VI secretion-associated protein [Pseudomonas sp. UW4]
MSLLKLITHCLGERDPLALARTQADSWQSWLQPISAQSPVGEDPGYDDDFQRMREEVNKLSGANVDEVIQ
LAEKLLGQRCKDLRVATYYLWARLQKDGETGLADGLGLLAALVERYADDVLPVRANSRKMALEWLTGGKV
LDSLSLYPEVVKTDAERTVAALAWLEHGLQAWPEDQRPQLDALHGALSARLAQSGGVDAVVPQHSASHES
VGQASAPDSLAIKSGRDLLDSGRKLADYLRDQPLGWLAAHRLMKSLRWDTLHEPPLQDASGTTRISPPRG
ESRAKLKRLYQQQNWSELLLQVEWIFAEGVNHFWLDLQWYLVQALSKLPAPHDGWADIVKRDLGMFLERL
PGLEALGWNDGTPFADETTREWIAQHVSAQQSRQLLPAAAPAAVMADGEILSLESEALAQADSDGVEHAL
AWLAARPDIHSGRQRWLLRLLMARVAEQCGKNDLALHLLGELDATAERQALADWEPELNFEVKARLLKLT
RLKAQRNDADKPALARRMETLLAALVAIDPVRASVLCG
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3612900-3611314 Pseudomonas sp. UW4 chromosome, complete genome
ATGAGCCTGCTCAAACTGATCACCCATTGCCTCGGCGAACGTGACCCGCTGGCCCTTGCCCGTACCCAGG
CCGACTCTTGGCAATCCTGGTTGCAGCCCATCAGCGCGCAGTCGCCGGTTGGTGAAGACCCGGGTTATGA
CGATGACTTCCAGCGCATGCGCGAAGAGGTCAACAAGCTCTCCGGCGCGAACGTCGACGAGGTGATTCAG
CTGGCGGAGAAGTTGCTCGGCCAGCGCTGCAAGGATCTGCGCGTCGCCACTTACTACCTGTGGGCACGCC
TGCAGAAGGACGGTGAGACAGGGTTGGCCGATGGCCTTGGTTTATTGGCGGCGCTGGTTGAGCGGTACGC
CGACGATGTGCTTCCCGTGAGGGCCAACAGCCGCAAGATGGCCCTGGAGTGGTTGACCGGCGGCAAGGTG
CTGGACAGCCTGTCGCTGTACCCGGAGGTGGTCAAGACCGATGCGGAACGCACGGTGGCGGCGCTGGCCT
GGCTTGAACATGGGTTGCAAGCCTGGCCCGAGGATCAGCGGCCGCAGCTGGATGCGTTGCATGGGGCGTT
GTCGGCGCGCCTGGCGCAGTCTGGTGGGGTCGATGCGGTGGTGCCGCAACACAGCGCCAGCCACGAGTCC
GTCGGCCAGGCCAGCGCGCCGGACAGCCTGGCCATCAAGTCCGGGCGCGACCTGCTGGACAGCGGCCGGA
AGCTGGCCGACTACCTGCGTGACCAGCCCCTGGGCTGGCTGGCGGCGCACCGCCTGATGAAGAGTTTGCG
CTGGGATACCTTGCACGAGCCGCCGCTACAGGACGCCAGCGGCACGACGCGTATTTCACCGCCCAGGGGA
GAATCCAGGGCGAAACTCAAGCGCTTGTATCAGCAACAGAACTGGAGCGAATTGCTTCTTCAGGTCGAAT
GGATATTCGCCGAGGGGGTCAACCATTTCTGGCTGGACCTGCAGTGGTACCTGGTCCAGGCCCTGAGCAA
ACTACCGGCGCCTCACGACGGCTGGGCCGACATCGTCAAGCGCGACCTGGGTATGTTCCTCGAGCGGCTG
CCGGGCCTGGAGGCGCTGGGGTGGAACGACGGTACACCGTTCGCCGACGAGACCACCCGTGAATGGATCG
CTCAGCACGTAAGCGCGCAACAGTCGCGCCAGCTCCTGCCCGCAGCGGCCCCGGCAGCGGTCATGGCCGA
TGGCGAGATTCTGTCCCTGGAAAGCGAGGCGCTGGCCCAGGCCGACAGCGACGGCGTCGAACATGCACTG
GCCTGGCTGGCCGCGCGCCCGGACATTCACAGCGGTCGCCAGCGCTGGCTGCTGCGCCTGCTGATGGCGC
GGGTGGCCGAGCAATGCGGCAAGAACGACCTGGCCCTGCACCTGCTCGGTGAACTGGATGCCACGGCCGA
GCGCCAGGCCTTGGCGGACTGGGAGCCGGAATTGAATTTCGAGGTCAAGGCCCGCCTGCTCAAGCTGACC
CGCCTGAAAGCGCAGCGCAACGATGCCGACAAGCCGGCCCTGGCCAGGCGCATGGAGACGTTGCTGGCGG
CGCTGGTTGCCATCGATCCGGTACGCGCCTCCGTACTGTGCGGTTGA