SecReT6
Protein ID: 426409984
SecReT6 ID713
T6SS typei2
Gene symbolvgrG1
Locus tagPputUW4_03083
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3620053..3624066 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDK9NM86
KEGG IDppuu:PputUW4_03083
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-57, Aligned region: 29..370
DUF2345 [PF10106], Evalue: 1.20E-45, Aligned region: 626..770
T6SS_Vgr [PF13296], Evalue: 1.10E-37, Aligned region: 503..605
DUF2235 [PF09994], Evalue: 8.40E-26, Aligned region: 150..182
DUF2235 [PF09994], Evalue: 8.40E-26, Aligned region: 869..1154
Phage_base_V [PF04717], Evalue: 5.20E-17, Aligned region: 419..496
Protein Sequence: 1337 a.a.     [Download]
>gi|426409984|ref|YP_007030083.1| ImpA family type VI secretion-associated protein [Pseudomonas sp. UW4]
MNPVFGHNRHTLKIDKLDTHLDVLAFEGHEHLSQPYLYRIEFTASDLDIGAEKFIGQYAEFSLYDAPSNV
PVFDWEVPRPSKPLRTVYGRITACQRLSASIDEARYEVTLQPRLALLDRGQQTRIYQHQSVPDIVKSILR
DRHGLDTGHFRFNLKREYPPREQVMQYQESDLAFISRILADVGIWYRCIQHEELAFDVVEFCDDQRCYQF
DVELPLRSPSGFSNSEQDSVWALKTRHRVVEQQVSVRAYHPDDSRAYLDGEVDQTRGEPATHGVATTRGV
ADNTYGDAYHYAEPYRVLGKSHLRDEDLQSESGFFYARLRHERYLNNQTHLSGTSSSATLAPGQVLTISG
DAPKAFASRVVITKITTRAARDRSLTCDFEAMPYALRLCFRPEVPPKPQIAGTLPARITHPQSNPLYTEI
DMQGRYRVKFLFDRDTWPAGRESKWLRQARAYAGDTYGLHLPLIAGTEVAIAFEQGDPDKPYIAHALHDD
QHPDLVTQRNDHRNVLRTPANNKLRLDDTRGQEHVKLSTEYGGKSQLNLGHLVDGQRKKRGEGFELRTDD
WGVIRGGKGLFISADAQTKAQGPVLDMDAAVGRLQQAGEQLQKLSVDAQAANAEPADVAAQLNLLRQDLE
QLKSQVLLLSAPQGIALTSGQHLQLAAKDNLMLNAGGETDLSVVKRLFIGVGQGLSLFVRKLGIKLIANQ
GAISVQAQNDKLELIARHGLDITSTEDEIHITAKKKIVLNGGGSYLSLEPCGIESGTAGDYKVKSADYQY
LQGKATQTPLIPKVPQRIDPPLEFHEQFRLFASDGEQPRANVPYKITAASGKVWKGTTDSQGFTERVYTA
KPEALSLTYDMEEEEEEEELEGITLRLGLFFDGTGNNLGNSAATEQCRRDDLELFDQSELASIVQLCKQY
GFDEFDGSGFASAPDSSYGNAPSNVAHLYDLYPDSTATPLKAEAEIGYVRVYLSGIGTRSGAKDSLVDQA
SGRGETGVVARVERVPAVLAEKLRDFIESNPGTCIRRIEFDIFGFSRGAAAARHCVNELFRPGRGVFAAL
LQGGRFGLPASFDPAVDVSLNLVGLFDTVAAILGMDLSVANDNNPGVNLYLPPGCARQIIQLQARDEHRL
NFALNSVLHGHRQISLPGVHSDIGGGYLPNGRERLWVTQPQRISVSAYQRPESHPQWAQLQAQALALRDS
GLSGSGTLEVKAWPIPPVPRGKAESKVDEYWLVIVLDRPVRGELALIALRLMRELGVRHGVPFEVISDED
KRLRLPDELQPIAEQILEQALAGNEVRLGPAEECLLRNRYIHQSAHWTPRAGLLINKPAPNKKRNVYPNQ
PQKGYPQ
 
Nucleotide Sequence: 4014 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3624066-3620053 Pseudomonas sp. UW4 chromosome, complete genome
ATGAACCCTGTCTTCGGCCACAACCGCCACACACTCAAGATCGACAAACTCGACACCCACCTCGACGTCC
TCGCCTTCGAGGGCCATGAGCACCTTAGCCAACCCTACCTCTACCGCATCGAATTCACCGCCAGCGACCT
CGACATCGGCGCGGAAAAATTCATCGGCCAGTACGCCGAGTTCAGCCTGTACGACGCACCGTCCAACGTG
CCCGTGTTCGACTGGGAAGTGCCCAGACCGTCCAAGCCCCTGCGCACCGTCTATGGCCGCATTACCGCCT
GCCAGCGCCTGTCCGCCTCAATCGACGAAGCCCGCTACGAAGTCACCCTGCAACCGCGCCTGGCCCTGCT
CGATCGCGGCCAGCAAACGCGGATCTATCAGCACCAGTCCGTGCCAGACATCGTCAAAAGCATCCTGCGC
GACCGCCACGGTCTGGACACCGGGCACTTTCGCTTCAACCTCAAGCGCGAATACCCGCCGCGCGAGCAGG
TGATGCAGTACCAGGAAAGCGACCTGGCTTTCATCAGCCGGATCCTGGCCGACGTCGGCATCTGGTACCG
CTGCATCCAGCACGAAGAGCTCGCCTTCGACGTCGTCGAGTTCTGCGACGACCAGCGCTGCTACCAGTTC
GACGTCGAGCTGCCGCTGCGCTCGCCGTCGGGCTTCAGCAACAGCGAGCAGGACAGCGTCTGGGCCCTGA
AAACCCGCCACCGGGTGGTGGAACAGCAGGTCAGCGTACGCGCCTATCACCCCGACGACAGCCGTGCCTA
CCTCGACGGCGAGGTCGACCAGACCCGCGGCGAGCCCGCCACCCACGGTGTGGCCACAACCCGCGGCGTC
GCCGACAACACCTACGGCGACGCCTACCACTACGCCGAACCCTATCGCGTGCTCGGCAAGTCCCACCTGC
GCGACGAAGACCTGCAAAGCGAAAGCGGCTTTTTCTACGCGCGCCTGCGCCACGAACGCTACCTCAACAA
CCAGACCCACCTCAGCGGCACCAGCAGCAGCGCCACCTTGGCCCCGGGTCAGGTCCTGACCATCAGCGGC
GACGCACCGAAGGCCTTCGCCTCCCGCGTGGTGATCACAAAGATCACCACCCGCGCCGCCCGCGACCGCA
GCCTGACCTGCGATTTCGAAGCCATGCCCTACGCCTTGCGCCTGTGCTTTCGCCCAGAAGTACCGCCCAA
ACCACAAATCGCCGGCACCCTGCCAGCGCGCATCACCCACCCCCAGAGCAACCCCCTGTACACCGAAATC
GACATGCAAGGGCGTTACCGGGTCAAATTCCTCTTCGACCGCGACACCTGGCCCGCCGGCCGCGAAAGCA
AATGGCTGCGCCAGGCCCGCGCCTACGCCGGCGACACCTACGGCCTGCACCTGCCGCTGATCGCCGGCAC
CGAAGTGGCCATCGCCTTCGAACAGGGCGACCCGGACAAACCCTACATCGCCCATGCCCTGCACGACGAC
CAGCACCCCGACCTGGTGACCCAGCGCAACGACCACCGCAACGTGCTGCGTACGCCGGCCAATAACAAGT
TGCGCCTGGACGACACGCGGGGGCAGGAGCACGTCAAGCTCAGCACCGAGTATGGCGGCAAGAGCCAACT
CAACCTCGGGCATCTGGTGGATGGCCAGCGGAAGAAACGTGGGGAAGGGTTTGAACTGCGTACGGATGAC
TGGGGCGTCATAAGAGGCGGCAAAGGCCTGTTCATCAGTGCCGATGCGCAGACCAAGGCGCAGGGCCCGG
TGCTGGACATGGACGCTGCCGTCGGCCGCCTGCAACAGGCCGGCGAACAACTGCAAAAGCTCTCGGTCGA
CGCCCAGGCCGCCAATGCCGAACCGGCGGACGTGGCAGCACAACTGAACCTGCTGCGCCAGGACCTCGAA
CAGCTCAAGTCCCAGGTCCTGCTGCTCAGCGCTCCGCAAGGCATCGCCCTCACCAGTGGCCAGCACCTGC
AACTGGCGGCCAAGGACAACCTGATGCTCAACGCCGGTGGCGAGACCGACCTCAGCGTGGTCAAGCGCCT
GTTCATCGGCGTCGGCCAGGGGTTGAGCCTGTTTGTGCGCAAGCTGGGGATCAAGCTGATTGCCAATCAG
GGGGCGATAAGCGTGCAGGCGCAAAACGACAAGCTGGAACTGATTGCCCGCCATGGCCTGGACATCACCA
GCACCGAAGACGAAATCCACATCACCGCGAAGAAGAAAATCGTCCTCAACGGGGGCGGCAGTTACCTCAG
CCTGGAACCGTGTGGCATCGAATCGGGCACGGCCGGGGACTACAAGGTCAAGTCGGCGGATTATCAGTAT
TTGCAGGGCAAAGCCACCCAGACCCCACTGATCCCGAAAGTGCCGCAACGCATCGACCCGCCGCTTGAGT
TTCATGAGCAATTCCGGCTATTCGCCAGCGATGGCGAGCAACCCCGCGCCAACGTGCCTTACAAAATCAC
CGCCGCTTCCGGCAAGGTCTGGAAAGGTACCACCGACAGCCAGGGCTTCACCGAGCGCGTGTACACCGCC
AAGCCTGAAGCGCTATCGCTGACCTACGACATGGAAGAAGAGGAGGAGGAAGAGGAGCTCGAAGGCATCA
CCCTACGCCTGGGGTTGTTCTTTGATGGCACGGGTAACAACTTGGGCAATTCCGCCGCCACAGAACAATG
CCGGCGGGACGACCTTGAATTGTTCGATCAGAGTGAACTGGCGAGCATTGTGCAGCTATGCAAGCAGTAT
GGGTTTGACGAGTTTGATGGCAGTGGTTTTGCCAGTGCACCGGATAGTAGTTACGGCAATGCGCCGAGCA
ATGTGGCGCATTTGTATGACCTGTACCCGGATAGCACAGCGACACCGCTCAAGGCAGAGGCAGAGATCGG
TTACGTAAGGGTCTATCTCTCGGGCATTGGCACTCGCAGTGGAGCCAAAGATTCGCTAGTGGATCAGGCC
TCTGGCCGGGGGGAAACCGGGGTGGTGGCGCGAGTTGAGCGGGTGCCTGCGGTATTGGCTGAAAAACTTC
GGGATTTTATTGAATCCAACCCCGGCACCTGTATTCGACGCATCGAGTTCGACATCTTCGGTTTCAGTCG
CGGGGCCGCCGCCGCGCGGCACTGTGTCAACGAATTGTTCAGGCCCGGGCGGGGAGTGTTCGCCGCGTTG
CTACAAGGCGGGCGTTTTGGCCTGCCGGCGAGTTTCGATCCGGCGGTGGATGTCAGCCTCAACCTGGTCG
GGCTGTTCGACACCGTTGCGGCGATCTTGGGGATGGACCTGAGCGTAGCCAACGACAACAACCCGGGGGT
CAACTTGTACCTGCCCCCCGGTTGTGCCCGCCAGATTATCCAGTTGCAGGCCCGGGACGAGCACCGTCTG
AACTTTGCCCTCAACAGCGTGCTGCACGGTCATCGACAAATCAGCCTGCCCGGCGTGCATTCGGATATCG
GCGGTGGCTACCTGCCGAACGGCCGGGAGCGCTTGTGGGTCACCCAGCCGCAGCGGATCAGCGTGTCGGC
CTACCAGCGGCCGGAGTCCCATCCGCAATGGGCGCAACTCCAGGCCCAGGCGCTGGCCCTGCGTGACAGT
GGCTTGTCCGGCAGTGGCACCCTTGAGGTCAAGGCTTGGCCGATCCCCCCGGTCCCGCGCGGTAAGGCTG
AATCGAAAGTGGATGAGTATTGGTTAGTGATCGTCCTCGACCGGCCTGTGCGTGGCGAATTGGCGCTGAT
TGCCCTGCGTTTGATGCGTGAACTGGGTGTGCGTCATGGCGTGCCGTTTGAAGTCATAAGTGACGAAGAC
AAACGCTTGCGCTTGCCCGATGAACTACAACCCATCGCCGAGCAAATCCTGGAGCAAGCGCTGGCGGGCA
ACGAAGTTCGACTCGGTCCCGCCGAGGAGTGCTTGTTGCGCAATCGCTACATTCACCAATCCGCTCACTG
GACCCCTCGTGCTGGTCTGCTCATCAACAAACCGGCGCCGAACAAAAAGCGCAACGTCTACCCCAACCAG
CCGCAGAAGGGGTATCCGCAATGA