SecReT6
Protein ID: 426409985
SecReT6 ID713
T6SS typei2
Gene symbolclpV
Locus tagPputUW4_03084
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3624063..3626705 [-]
ProductClpV1 family type VI secretion ATPase
NoteTssH
UniProt IDK9NKK1
KEGG IDppuu:PputUW4_03084
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-41, Aligned region: 226..245
AAA_2 [PF07724], Evalue: 2.20E-41, Aligned region: 601..765
AAA [PF00004], Evalue: 8.40E-19, Aligned region: 228..341
AAA [PF00004], Evalue: 8.40E-19, Aligned region: 606..734
AAA_5 [PF07728], Evalue: 3.60E-14, Aligned region: 228..248
AAA_5 [PF07728], Evalue: 3.60E-14, Aligned region: 301..358
AAA_5 [PF07728], Evalue: 3.60E-14, Aligned region: 605..726
ClpB_D2-small [PF10431], Evalue: 6.50E-13, Aligned region: 440..455
ClpB_D2-small [PF10431], Evalue: 6.50E-13, Aligned region: 470..502
ClpB_D2-small [PF10431], Evalue: 6.50E-13, Aligned region: 774..849
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 113..133
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 205..249
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 272..307
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 474..499
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 575..649
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 670..700
AAA_16 [PF13191], Evalue: 8.00E-10, Aligned region: 746..786
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 37..78
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 227..313
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 346..386
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 603..624
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 667..699
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 228..252
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 281..316
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 603..634
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 738..809
IstB_IS21 [PF01695], Evalue: 7.00E-06, Aligned region: 132..157
IstB_IS21 [PF01695], Evalue: 7.00E-06, Aligned region: 222..289
IstB_IS21 [PF01695], Evalue: 7.00E-06, Aligned region: 605..623
AAA_17 [PF13207], Evalue: 8.40E-06, Aligned region: 228..330
AAA_17 [PF13207], Evalue: 8.40E-06, Aligned region: 604..640
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 228..314
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 605..628
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 725..754
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 209..288
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 604..726
AAA_19 [PF13245], Evalue: 2.80E-05, Aligned region: 225..257
AAA_19 [PF13245], Evalue: 2.80E-05, Aligned region: 603..627
Zeta_toxin [PF06414], Evalue: 4.70E-05, Aligned region: 222..252
Zeta_toxin [PF06414], Evalue: 4.70E-05, Aligned region: 590..645
Arch_ATPase [PF01637], Evalue: 7.60E-05, Aligned region: 206..243
Arch_ATPase [PF01637], Evalue: 7.60E-05, Aligned region: 280..376
Arch_ATPase [PF01637], Evalue: 7.60E-05, Aligned region: 604..617
Arch_ATPase [PF01637], Evalue: 7.60E-05, Aligned region: 676..691
Clp_N [PF02861], Evalue: 7.80E-05, Aligned region: 23..65
Clp_N [PF02861], Evalue: 7.80E-05, Aligned region: 106..124
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 228..329
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 604..695
AAA_18 [PF13238], Evalue: 0.00049, Aligned region: 83..153
AAA_18 [PF13238], Evalue: 0.00049, Aligned region: 228..251
AAA_18 [PF13238], Evalue: 0.00049, Aligned region: 606..629
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 83..113
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 228..249
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 604..634
DUF258 [PF03193], Evalue: 0.0054, Aligned region: 213..245
DUF258 [PF03193], Evalue: 0.0054, Aligned region: 604..617
AAA_29 [PF13555], Evalue: 0.0056, Aligned region: 222..244
AAA_29 [PF13555], Evalue: 0.0056, Aligned region: 601..624
Protein Sequence: 880 a.a.     [Download]
>gi|426409985|ref|YP_007030084.1| ClpV1 family type VI secretion ATPase [Pseudomonas sp. UW4]
MSHHSTRLLRRLNPYCAQALSAAASLCQSRAHGRISIEHWLLKLLEQGEGDLTLIARRHEWDMDALWRGL
LDHLDRLPRSVQGKPQLCGKLQKLIENAWLRASLEGNDNLRSAHLLGALLESPDLLACEAAWSILDLSET
QLQQLFALLDQHSEERPHVQQQSALDPLPATPLADGAGHDALQAVLDIFTQDVTAKARAGQIDPVFGRDD
EIRQVIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKAVSVRTLDLGLLQAGAGVKGEF
EQRLKNVIDAVQQSANPVLLFIDEAHTLIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFER
DAALERRFQVVKVDEPDDASACLMLRGLKARYASHHGVHIQDAAVQAAVSLSRRYLTGRQLPDKAVDLLD
TASARVRMSLDCEPQALVRLKARHAALELERRALEQDVQLNGSDLSERLTLIAGQQVEMQQQQDDLLCQY
RYELDLTRQLLDAREAEPARSDLCAKLQEQLLRAQGSQPMLSLDVDARSVAEVIADWTGVPLGSLLKDEQ
ASLLTLEWQLGERVIGQESALGALAQRLRAAKTGLTEEQAPLGVFLLVGTSGVGKTETALALADCLFGGE
KSLITLNLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRQRPYSVVLLDEVEKAHRDVLNLFYQVFDR
GFMRDGEGREIDFRNTVILMTSNLGSDELQNGLREQPEASDSDLHEWLRPLLREHFQPALLARFQTLIYR
PLLADALKHIVALKLAKVASRLHSHYGLACVIEDGLHDALVAACLLPDTGARNIDSLLNQQILPVLSQQL
LQRQAAKYKTLGVTLGYSDEEGITLQFTDGPSVVAPEGRA
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3626705-3624063 Pseudomonas sp. UW4 chromosome, complete genome
ATGTCCCATCATTCCACGCGCTTGCTTCGCCGCCTCAATCCTTACTGCGCCCAGGCGCTCAGCGCGGCGG
CTTCGTTGTGTCAAAGCCGTGCCCATGGGCGGATCAGCATCGAACACTGGCTGCTCAAGTTGCTGGAGCA
GGGCGAGGGCGATCTGACCCTCATTGCGCGTCGCCATGAGTGGGACATGGATGCACTTTGGCGCGGGTTG
CTCGACCACCTCGACAGGCTGCCGCGCAGCGTGCAGGGCAAGCCGCAGTTGTGCGGCAAGTTGCAAAAGC
TCATCGAGAACGCCTGGCTGCGTGCATCGCTGGAGGGTAACGACAACCTGCGTTCGGCACACTTGCTTGG
CGCATTGCTGGAGAGTCCGGACCTGCTGGCTTGCGAAGCGGCCTGGTCAATACTGGACCTCAGCGAAACC
CAGTTGCAGCAGTTGTTTGCCTTGCTCGACCAACACTCCGAGGAACGCCCGCACGTCCAACAGCAAAGCG
CGTTGGACCCGCTCCCGGCGACGCCGCTCGCCGACGGTGCCGGGCACGATGCCTTGCAAGCGGTACTGGA
CATATTCACCCAGGACGTCACCGCCAAGGCGAGGGCAGGGCAGATCGACCCGGTGTTCGGGCGTGACGAT
GAAATCCGCCAGGTCATCGACATCCTCAGCCGGCGGCGCAAGAACAACCCGATCCTGGTCGGCGAGCCCG
GCGTCGGCAAGACCGCGCTGGTCGAAGGCCTGGCCCTGCGCATTGCCGATGGCAACGTGCCCGACAGCCT
CAAGGCAGTCAGCGTGCGCACCCTGGACCTTGGCCTGCTGCAAGCAGGCGCCGGGGTAAAAGGCGAATTC
GAACAACGCCTGAAAAACGTCATCGACGCCGTGCAGCAGTCGGCCAACCCGGTGCTGCTGTTCATCGACG
AGGCTCACACCCTGATCGGCGCCGGTAACCAGGCGGGCGGGGCGGATGCGGCGAATCTGCTCAAGCCGGC
CCTCGCGCGAGGCGAATTGCGCACCATCGCCGCGACCACCTGGAGCGAATACAAACAGTACTTCGAACGT
GATGCTGCGCTGGAGCGGCGTTTCCAGGTGGTCAAGGTCGACGAGCCGGACGATGCCAGCGCCTGCCTGA
TGCTGCGTGGCCTCAAGGCGCGTTACGCCAGCCATCACGGCGTGCACATTCAGGACGCGGCGGTGCAGGC
CGCGGTCAGCCTGTCGCGGCGTTATCTCACCGGCCGCCAGCTGCCGGACAAGGCCGTCGACCTGCTCGAC
ACCGCCAGCGCGCGGGTGCGCATGAGCCTCGACTGCGAGCCCCAGGCACTGGTGCGGCTCAAGGCCCGGC
ATGCCGCGCTGGAGCTGGAGCGGCGCGCACTGGAACAGGATGTGCAACTCAATGGCAGCGACTTGAGCGA
ACGATTGACGCTGATCGCCGGGCAGCAGGTCGAGATGCAACAACAGCAGGACGACTTGCTGTGCCAGTAC
CGCTATGAACTTGACCTGACCCGACAATTGCTCGATGCGCGTGAGGCCGAACCGGCCCGCAGCGACCTCT
GCGCGAAACTGCAGGAGCAATTGCTGCGGGCTCAGGGCAGCCAGCCAATGCTGTCCCTGGACGTCGATGC
ACGCAGTGTTGCGGAAGTCATCGCCGACTGGACCGGCGTGCCCCTGGGCAGTTTGCTCAAGGACGAACAA
GCCAGCCTGCTGACTCTGGAATGGCAACTCGGCGAGCGGGTGATTGGCCAGGAATCTGCCCTCGGTGCCT
TGGCCCAGCGCCTGCGCGCAGCCAAGACCGGCTTGACCGAAGAGCAGGCGCCGTTGGGGGTATTCCTGTT
GGTGGGCACCAGCGGCGTCGGCAAGACCGAAACCGCCCTGGCGCTGGCGGACTGCCTGTTCGGTGGCGAA
AAATCCCTGATCACCCTCAACCTGTCCGAGTACCAGGAGGCCCACACCGTCAGCCAGCTCAAGGGCTCGC
CACCGGGTTACGTAGGTTACGGCCAGGGCGGCGTGCTCACCGAAGCGGTGCGCCAGCGGCCCTATAGCGT
GGTGCTGCTGGATGAGGTGGAAAAGGCCCACCGCGACGTGCTCAACCTGTTCTACCAGGTGTTCGACCGC
GGCTTCATGCGTGATGGCGAAGGACGCGAAATCGACTTCCGCAACACTGTCATCCTGATGACCTCCAACC
TCGGCAGCGATGAGCTGCAAAACGGTCTGCGCGAACAGCCCGAAGCCAGCGACAGCGACTTGCACGAATG
GCTGCGACCGCTGCTGCGCGAGCACTTCCAGCCGGCGTTGCTCGCCCGCTTCCAGACCCTGATCTACCGC
CCGCTGCTGGCCGACGCGCTCAAGCATATCGTCGCCCTGAAACTTGCCAAGGTCGCCAGTCGCCTGCACA
GCCATTACGGCCTGGCCTGCGTGATTGAGGATGGCCTGCACGATGCATTGGTCGCCGCCTGCCTGCTGCC
CGACACCGGTGCGCGCAACATCGACAGCCTGCTCAACCAGCAGATTCTGCCGGTCCTCAGTCAACAGTTG
CTGCAGCGTCAGGCCGCCAAATACAAAACCCTTGGCGTAACCCTGGGCTACAGCGATGAGGAGGGCATCA
CGCTGCAATTCACCGACGGACCTTCAGTCGTTGCACCTGAGGGCCGAGCATGA