SecReT6
Protein ID: 426409986
SecReT6 ID713
T6SS typei2
Gene symbolhcp
Locus tagPputUW4_03085
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3626852..3627343 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDK9NM40
KEGG IDppuu:PputUW4_03085
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.70E-35, Aligned region: 6..147
Inhibitor_I24 [PF10465], Evalue: 0.0091, Aligned region: 88..157
Protein Sequence: 163 a.a.     [Download]
>gi|426409986|ref|YP_007030085.1| type VI secretion system effector [Pseudomonas sp. UW4]
MATPIYLWLKNNADDDIKGSVDVQQREGSIEVVAQDHSLYIPTDNNTGKLTGTRVHTPFQFSKEIDASSP
YFYRAVATGLTLKSAEFKWYRINNDGQEVEYFNTILEKVKVVKVAQKMHDVKDPSKEKHNHLEEIELRYE
KITWTYKDGNVTYSDSWSERPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3627343-3626852 Pseudomonas sp. UW4 chromosome, complete genome
ATGGCAACTCCCATTTACCTGTGGCTGAAAAATAACGCCGACGATGACATCAAAGGTTCGGTGGACGTGC
AACAGCGTGAAGGCAGCATTGAGGTGGTCGCCCAGGACCACAGCCTCTACATCCCCACTGACAACAACAC
CGGCAAGTTGACTGGCACGCGGGTCCATACCCCGTTTCAGTTCAGCAAGGAAATCGATGCCTCAAGTCCA
TACTTCTATAGGGCGGTGGCCACCGGCCTGACCCTGAAAAGCGCCGAGTTCAAGTGGTATCGCATCAACA
ATGACGGCCAGGAAGTCGAGTACTTCAACACCATTCTGGAGAAGGTGAAGGTGGTGAAAGTCGCGCAGAA
AATGCACGACGTGAAAGATCCGTCCAAGGAAAAACACAACCACCTGGAGGAGATCGAGTTGCGGTACGAG
AAGATCACCTGGACCTACAAGGATGGCAACGTCACCTACTCCGACTCCTGGAGCGAGCGCCCGAGTGCCT
GA