SecReT6
Protein ID: 426409988
SecReT6 ID713
T6SS typei2
Gene symboltssL
Locus tagPputUW4_03087
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3629097..3629780 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDK9NKX8
KEGG IDppuu:PputUW4_03087
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.40E-43, Aligned region: 16..213
DUF1045 [PF06299], Evalue: 0.0081, Aligned region: 27..79
DUF1045 [PF06299], Evalue: 0.0081, Aligned region: 160..170
Protein Sequence: 227 a.a.     [Download]
>gi|426409988|ref|YP_007030087.1| DotU family type IV/VI secretion system protein [Pseudomonas sp. UW4]
MNLIEAKKQAAMTVDIDALLQDSYLLVVELRQGASAQSSDEVKALCVKQVEHVRQRLMDAGLAQRSIDHI
SHAQCALLDETMLNRADNDAHSRWASEPLQAKFFNRHQAGEFLYEDMREVLREPAPDLQVLTTFQRVLTL
GFRGRYRDDNDPEREQLLADLNARVAPLKLRQALTAPLSASHGAMALRWMRSPLVNVLAAGLLLAGVWYG
LDQLLGSLVATLLAAQA
 
Nucleotide Sequence: 684 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3629780-3629097 Pseudomonas sp. UW4 chromosome, complete genome
ATGAACCTGATCGAAGCGAAAAAACAGGCCGCCATGACGGTCGACATCGACGCGTTGTTGCAAGACAGCT
ACCTGCTGGTGGTCGAGTTGCGGCAAGGGGCCTCCGCGCAAAGCAGCGATGAGGTCAAGGCGCTTTGCGT
AAAGCAGGTCGAGCACGTTCGCCAGCGGCTCATGGATGCCGGCCTGGCCCAACGCAGCATCGACCATATC
AGCCACGCTCAATGTGCGCTGCTGGATGAGACCATGCTCAACCGCGCCGATAACGATGCCCATTCCCGGT
GGGCCAGTGAACCCTTGCAGGCGAAGTTTTTCAATCGCCACCAGGCCGGGGAGTTCCTGTACGAGGACAT
GCGTGAGGTACTGCGCGAACCGGCGCCGGACCTTCAGGTACTGACGACCTTCCAGCGGGTTTTGACCCTG
GGGTTTCGCGGCCGTTATCGCGATGACAATGACCCCGAGCGTGAACAACTGCTGGCCGACCTGAATGCCC
GGGTCGCACCACTGAAGTTACGTCAGGCATTAACCGCACCCCTCAGCGCCAGCCATGGCGCAATGGCGCT
GCGCTGGATGCGCTCGCCGCTGGTCAACGTCCTGGCTGCCGGTCTGTTGCTGGCCGGTGTCTGGTACGGC
CTCGACCAGCTGTTGGGTAGTCTGGTTGCGACGCTGTTGGCCGCGCAAGCCTGA