SecReT6
Protein ID: 426409989
SecReT6 ID713
T6SS typei2
Gene symbol-
Locus tagPputUW4_03088
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3629777..3631132 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDK9NM92
KEGG IDppuu:PputUW4_03088
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-134, Aligned region: 18..448
Protein Sequence: 451 a.a.     [Download]
>gi|426409989|ref|YP_007030088.1| type VI secretion protein [Pseudomonas sp. UW4]
MKIDRPLWAAGALLSPQQFQQQARWEAWANERLARLSLVHPWGVQDVAFDLHALRLGKLKATRLSLRMPD
GTLIDTDHVDRLPLGLELSRLLSDDTQAATLLLALPLEQANGNNCLFDADKADRPTRYRQDWRQVQDIYA
DEVQSVGVLEYVLSLRFDHDENGDYLTCPIARLVRDGQGAWSLDPDYVPPLLSFAAHPGLLTQLDNLLTQ
LSSKRQRLMGMRRESNQRMADFAVADVSLFWLLNALNTYQPVLADLKAWPARHPEQVYLELTKLAGSLLT
FSLEHDVEQIPPYRHEHLESVFPPLLRMISTLLEASLPSRVIALTLEQSAANRWQVRLDDARLREPDSAD
FYLSVRCRLPAVQLQSQFPQLCKIGTPDEVDHLVNAALDGVPLQSLSHVPAAIPLRLENQYFALDLNHAK
GQAIRDQGICALYVPSTLAEVKLELFAVLRA
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3631132-3629777 Pseudomonas sp. UW4 chromosome, complete genome
ATGAAAATCGACCGCCCCTTGTGGGCCGCGGGGGCATTGCTGTCCCCGCAGCAATTCCAGCAGCAGGCGC
GCTGGGAAGCCTGGGCCAACGAGCGTCTGGCTCGTCTGTCCCTGGTGCACCCCTGGGGCGTCCAGGACGT
CGCGTTTGACCTGCACGCACTGCGCCTGGGCAAGCTCAAGGCCACTCGCCTGAGCCTGCGCATGCCCGAC
GGCACCTTGATCGACACCGACCATGTGGATCGACTGCCCCTGGGGCTGGAGCTGTCGCGCCTGCTGTCCG
ACGATACCCAGGCGGCGACCTTGCTCCTGGCCTTGCCACTGGAACAGGCCAATGGCAACAACTGCCTGTT
CGACGCCGACAAGGCCGATCGACCCACCCGTTATCGCCAGGACTGGCGTCAGGTGCAGGACATTTACGCC
GATGAAGTGCAATCGGTCGGCGTACTGGAATACGTGCTGAGCCTGCGCTTCGATCACGACGAGAACGGCG
ATTACCTGACCTGCCCGATCGCGCGCCTGGTACGTGACGGGCAGGGCGCCTGGAGCCTTGATCCTGACTA
TGTACCACCGCTGCTCAGTTTCGCGGCGCACCCGGGTCTGTTGACGCAACTGGACAACCTGTTGACCCAG
TTGTCCTCCAAGCGTCAGCGGCTGATGGGCATGCGCCGTGAGAGTAACCAGCGAATGGCCGACTTCGCCG
TGGCCGACGTGTCGTTGTTCTGGTTGCTCAATGCCTTGAACACCTACCAGCCGGTATTGGCCGATCTCAA
GGCCTGGCCGGCGCGACATCCCGAGCAGGTCTATCTGGAGCTGACAAAACTGGCCGGCAGTCTGCTGACC
TTTTCGCTCGAACACGATGTCGAGCAGATTCCGCCTTATCGCCACGAACACCTGGAAAGCGTGTTCCCGC
CGCTGTTGCGCATGATCTCCACGTTGCTGGAGGCCAGCCTGCCTTCTCGCGTCATCGCCCTGACACTCGA
GCAGAGCGCAGCCAACCGTTGGCAGGTCCGACTTGACGACGCCCGTTTGCGCGAGCCCGACAGCGCCGAC
TTCTATCTGTCGGTGCGTTGCCGCTTGCCAGCCGTGCAATTGCAGAGTCAGTTCCCGCAACTGTGCAAGA
TCGGCACACCGGACGAAGTCGATCACCTGGTCAACGCCGCCCTCGATGGCGTGCCGTTGCAGTCCCTCAG
TCATGTCCCGGCGGCCATCCCCTTGCGTCTGGAAAACCAGTACTTCGCCCTGGATCTCAACCATGCCAAG
GGACAAGCCATTCGGGACCAGGGTATCTGTGCCTTGTACGTCCCGAGCACCCTGGCCGAAGTGAAACTTG
AACTGTTCGCGGTACTACGCGCATGA