SecReT6
Protein ID: 426409990
SecReT6 ID713
T6SS typei2
Gene symboltssC
Locus tagPputUW4_03089
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3631174..3632712 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDK9NKK5
KEGG IDppuu:PputUW4_03089
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-174, Aligned region: 87..508
Protein Sequence: 512 a.a.     [Download]
>gi|426409990|ref|YP_007030089.1| EvpB family type VI secretion protein [Pseudomonas sp. UW4]
MSIEHSHAQSRGTTVLPEESQGVYGALFGKINLNPVKVLGEIEVFQSSEALSDVSADERVTAAVSVFLNL
IKQSSRKVRRLDRTLLDEHIASLDAQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDI
SKDHLVQDFEDAPEIAQSGLYVHTYTQEYDTPGGEPIAAAISNFEFDRSPQDIALLRNISKVSAAAHMPF
IGSVGPAFFGKHSMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDARYIGLLMPRVLGRLPYGPDTVPVRSF
NYIESVKGPDHDKYLWTNASFAFAANMVKSFIANGWCVQIRGPQSGGAVTDLPIHLYDLGTGNQVKIPSE
VMIAETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTPEATANSRINARLPYIFLLSRIAHYL
KLIQRENIGTTKDRRLLELELNKWVSGLVTEMNDPGDSLQASHPLRAGRVTVEDIEDNPGFFRVKLYAVP
HFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3632712-3631174 Pseudomonas sp. UW4 chromosome, complete genome
ATGTCTATCGAACATTCTCACGCGCAATCGCGCGGCACTACAGTGTTGCCTGAAGAAAGCCAAGGCGTGT
ATGGCGCGTTGTTTGGCAAGATCAATCTCAACCCGGTAAAAGTGCTGGGCGAAATTGAAGTGTTTCAAAG
TTCCGAGGCGCTGTCGGACGTTTCTGCCGATGAGCGAGTGACTGCCGCTGTCAGTGTTTTCTTGAATTTG
ATCAAACAGTCTTCGCGCAAAGTCCGGCGTCTGGACAGGACACTGCTGGATGAACATATTGCGTCGCTGG
ATGCACAAATCAGCCGCCAACTGGACGCCGTGATGCATCACCCGGATTTCCAGCGGGTGGAGTCCACCTG
GCGCGGTGTGAAATCGCTGATCGATCAGACCGACTTCCGCCAGAACGTGCGCATCGAATTGCTTGATATC
AGCAAGGATCACCTGGTCCAGGATTTCGAGGATGCACCGGAGATCGCACAAAGTGGCCTGTATGTGCATA
CCTACACCCAGGAGTACGACACCCCGGGTGGTGAGCCGATCGCCGCTGCCATTTCCAACTTCGAGTTCGA
CCGCAGCCCGCAGGACATTGCCTTGCTGCGCAATATTTCCAAAGTCTCGGCAGCCGCGCACATGCCCTTC
ATTGGCTCCGTCGGCCCGGCCTTTTTTGGCAAGCACTCGATGGAAGAAGTCGCCGCCATCAAGGACATCG
GCAACTACTTTGATCGTGCCGAATACATCAAGTGGAAAGCGTTCCGCGACAGCGACGATGCCCGCTATAT
CGGCTTGCTCATGCCCCGCGTGCTGGGCCGTCTGCCGTATGGCCCGGACACCGTTCCGGTGCGCAGCTTC
AACTACATCGAAAGCGTCAAGGGACCGGACCACGACAAATACCTGTGGACCAACGCCTCGTTTGCCTTCG
CTGCCAACATGGTCAAGAGCTTTATCGCCAACGGCTGGTGCGTGCAGATCCGCGGTCCGCAGTCTGGCGG
CGCGGTCACCGACTTGCCGATCCACTTGTATGATCTGGGCACTGGCAATCAGGTGAAGATCCCTTCGGAA
GTGATGATTGCGGAGACGCGCGAGTTCGAGTTCGCCAACCTCGGTTTCATCCCGCTCTCGTACTACAAGA
ACCGTGACTATGCGTGCTTCTTCTCGGCCAACTCCACGCAGAAACCGGCGCTATACGATACCCCTGAGGC
CACCGCCAATAGCCGGATCAATGCGCGCCTGCCCTACATCTTCCTGCTGTCACGCATTGCCCATTACCTG
AAGCTGATCCAGCGCGAAAACATCGGCACCACCAAGGATCGCCGATTGCTGGAGCTGGAGCTGAACAAGT
GGGTCAGCGGGCTGGTCACCGAGATGAACGATCCGGGCGACTCGCTGCAGGCTTCGCACCCGTTGCGGGC
TGGCCGGGTCACCGTCGAAGACATCGAGGACAACCCGGGTTTCTTCCGCGTCAAGTTGTACGCCGTGCCG
CATTTCCAGGTGGAAGGCATGGACGTCAACCTGTCGCTGGTTTCGCAGATGCCCAAGGCAAAAGCCTGA