SecReT6
Protein ID: 426409991
SecReT6 ID713
T6SS typei2
Gene symboltssB
Locus tagPputUW4_03090
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3632746..3633249 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDK9NM45
KEGG IDppuu:PputUW4_03090
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-56, Aligned region: 7..159
Protein Sequence: 167 a.a.     [Download]
>gi|426409991|ref|YP_007030090.1| type VI secretion protein [Pseudomonas sp. UW4]
MASGSFQNEVPKARVNIKLDLHTGDAQKKVELPLKLMVMGDYSNGKEQRPLSERSKVAIDKNNFDSVLAE
FSPEVKLAVANTLAEDAGEAAVNLGFRSMKDFEPEQVARQIPQLRALLAMRNLLRDLKSNLLDNATFRQE
LERILMDEALSDELRGELAALTPEHIR
 
Nucleotide Sequence: 504 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3633249-3632746 Pseudomonas sp. UW4 chromosome, complete genome
ATGGCTTCTGGTAGTTTTCAAAACGAAGTGCCCAAGGCACGGGTCAACATCAAGCTCGATTTGCATACGG
GCGATGCACAGAAAAAAGTCGAATTGCCGCTCAAGTTGATGGTGATGGGCGACTACAGTAACGGCAAGGA
ACAGCGGCCGTTGTCCGAGAGAAGCAAAGTCGCCATCGACAAGAATAATTTCGATAGCGTGCTGGCCGAG
TTTTCTCCCGAGGTCAAGCTGGCGGTGGCCAATACCCTGGCGGAGGATGCCGGCGAAGCGGCGGTCAACC
TGGGTTTCCGGAGCATGAAGGACTTCGAGCCGGAACAAGTGGCTCGGCAAATTCCGCAACTGCGCGCACT
GCTGGCAATGCGTAACCTGCTGCGCGACCTCAAGTCCAACCTGTTGGACAATGCCACGTTCCGTCAGGAA
CTGGAGCGTATTCTCATGGACGAGGCACTGAGTGACGAACTGCGAGGTGAGTTGGCGGCACTGACTCCGG
AACACATTCGTTAA