SecReT6
Protein ID: 430743279
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2402
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2962010..2964067 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0DCZ9
KEGG IDsaci:Sinac_2402
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.20E-67, Aligned region: 30..358
Phage_base_V [PF04717], Evalue: 1.60E-27, Aligned region: 398..491
Protein Sequence: 685 a.a.     [Download]
>gi|430743279|ref|YP_007202408.1| Rhs element Vgr protein [Singulisphaera acidiphila DSM 18658]
MATYLQADRIMTVTTPLKKDALLMAGFSGHESISQLFEYRLELFATNDEPIPFEKLLGQKAIVSLALEGN
KRRYFSGICNRVSQGARDSTFTAYHIDVVPQFWFLTKRAQSRIFQQVSVPQILQQVLEGLDVSYDLRGTY
QSRDYCVQYRETDYNFACRLMEEEGICFFFKHSANGHTLVVTDVPQAFPELPGKARMTLGRSEEEVSGEE
LVLSWEKTQELRSGRYLLWDHSFELPHKHLEADKQIADSVMAGQVAHKLRIGNNDKLELYDYPGEYAQRF
DGINPSGGDRAGDLQKIFGDNKRTVEIRMQEEAAASLLIQGEGTCRNFATGHAVVLDNHYNANGKYLITG
IRHMARQSYNFRSSNESAEFSYRNSFTCMPFDLPYRPARKTPKPAVQGTQTAVVVGPAGEEIFTDKYGRV
KVQFHWDRQGKNDNNSSCWIRVGTPWAGKNWGMIHIPRIGQEVIVDFQEGDPDQPIIIGSVYNAAMMPPY
DLPANKTQSGVKSRSSLKGSDANFNELRFEDKKGEEDVYFHAEKDFHRVVERDDDLKVHRDQTVTIDRDR
TEQVKRNEKVTVDNNRDVIVSQGNDTHNVKMGNRSVKIDMGNDALTIKMGNQTTKLDLGKSETQALQSIE
LKVGQSSIKIDQMGVQIKGMMIDINGQIQTQVKGMMTQVSASAILQVKGALTMIG
 
Nucleotide Sequence: 2058 bp     [Download]
>gi|430741030|ref|NC_019892.1|:2962010-2964067 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGGCGACCTATTTGCAAGCCGATCGGATCATGACGGTCACGACGCCGTTAAAAAAGGATGCACTCCTGA
TGGCCGGCTTCTCCGGTCACGAGTCGATCTCTCAGCTTTTCGAGTATCGCCTCGAACTGTTCGCCACGAA
TGACGAGCCGATCCCGTTCGAGAAATTGCTCGGTCAAAAGGCAATTGTCAGCCTGGCGCTCGAGGGCAAC
AAACGAAGATACTTTAGCGGGATCTGCAACCGGGTGAGTCAGGGGGCGCGTGACAGCACGTTCACGGCCT
ACCATATCGACGTCGTCCCGCAGTTCTGGTTCCTGACCAAGCGCGCGCAGAGCCGGATCTTCCAGCAGGT
GTCGGTGCCCCAGATCCTCCAGCAGGTCCTCGAAGGCCTGGATGTCTCTTACGACTTGCGAGGCACCTAT
CAATCCCGCGACTACTGCGTGCAGTATCGCGAAACCGACTACAACTTCGCCTGCCGACTCATGGAAGAAG
AAGGGATCTGCTTCTTCTTCAAGCACTCAGCCAACGGCCATACCCTCGTCGTGACGGACGTGCCCCAAGC
CTTCCCCGAACTTCCTGGGAAGGCCAGGATGACGCTCGGCCGGTCGGAGGAGGAGGTGAGCGGTGAGGAG
CTGGTCCTCTCGTGGGAGAAAACCCAGGAACTTCGATCGGGGCGATACCTGCTCTGGGATCATAGCTTCG
AGCTTCCTCACAAGCATCTGGAAGCGGATAAGCAGATCGCCGACAGTGTCATGGCAGGGCAGGTGGCGCA
CAAACTCCGCATTGGGAACAACGACAAACTCGAGTTGTACGACTATCCCGGCGAATACGCCCAGCGGTTC
GACGGCATCAACCCCAGCGGGGGCGACCGTGCGGGCGACCTGCAAAAGATTTTCGGAGACAACAAACGGA
CCGTCGAGATCCGGATGCAGGAGGAGGCGGCGGCCAGCTTGTTGATCCAGGGCGAAGGCACCTGCCGGAA
CTTCGCTACGGGTCATGCGGTCGTACTCGACAACCACTATAATGCGAATGGCAAATATCTGATTACGGGT
ATTCGCCACATGGCAAGGCAGAGCTACAATTTCCGGTCGTCGAACGAGTCGGCGGAATTTTCCTATCGCA
ACTCATTCACTTGCATGCCTTTCGACCTCCCCTACCGCCCCGCGCGGAAAACGCCGAAACCGGCCGTCCA
GGGGACGCAAACGGCCGTGGTGGTGGGCCCGGCCGGCGAGGAGATCTTCACCGACAAGTACGGCCGGGTG
AAAGTCCAGTTCCACTGGGATCGTCAGGGTAAAAACGACAATAACAGCTCCTGCTGGATCCGAGTCGGCA
CCCCTTGGGCCGGCAAGAACTGGGGGATGATCCACATCCCTCGGATCGGCCAGGAGGTCATCGTTGACTT
CCAGGAGGGAGATCCTGACCAGCCGATCATCATCGGCAGCGTCTACAACGCCGCGATGATGCCTCCCTAC
GACCTCCCGGCGAACAAGACTCAGAGCGGCGTCAAGTCCCGCAGCTCCCTGAAGGGGTCCGACGCCAACT
TCAACGAGCTCCGCTTCGAGGACAAGAAGGGGGAGGAGGATGTCTACTTCCATGCCGAGAAGGATTTTCA
TCGGGTCGTTGAACGCGATGACGACCTCAAGGTCCACCGCGATCAGACCGTCACGATCGATCGGGACCGC
ACCGAGCAAGTCAAGCGCAACGAGAAGGTCACCGTCGACAACAATCGCGACGTTATCGTGAGCCAAGGCA
ACGACACGCACAACGTGAAGATGGGCAACCGCTCCGTCAAGATTGACATGGGCAATGATGCCTTGACGAT
TAAGATGGGCAATCAGACCACGAAGCTCGACCTGGGCAAGAGCGAAACCCAGGCCTTGCAGTCGATCGAA
CTCAAAGTCGGCCAAAGCAGCATCAAGATCGATCAAATGGGCGTTCAGATCAAAGGGATGATGATCGATA
TCAATGGGCAGATCCAGACCCAGGTCAAGGGCATGATGACCCAGGTCAGCGCCTCCGCCATCCTGCAAGT
CAAGGGCGCCCTGACCATGATCGGTTAG