SecReT6
Protein ID: 430743281
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2404
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2964887..2965177 [+]
Producthypothetical protein
NotePAAR
UniProt IDL0DCW8
KEGG IDsaci:Sinac_2404
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.50E-22, Aligned region: 3..16
PAAR_motif [PF05488], Evalue: 1.50E-22, Aligned region: 22..89
DUF4150 [PF13665], Evalue: 8.90E-06, Aligned region: 3..12
DUF4150 [PF13665], Evalue: 8.90E-06, Aligned region: 32..50
DUF4150 [PF13665], Evalue: 8.90E-06, Aligned region: 59..84
Protein Sequence: 96 a.a.     [Download]
>gi|430743281|ref|YP_007202410.1| hypothetical protein Sinac_2404 [Singulisphaera acidiphila DSM 18658]
MPMPAARVGDMHVCPLITVLVPHVGGPILPPGALTVLIGGQPAARVGDLAVCVGPPDVVVLGSFTVLISG
QPAARLGDITAHGGAIVMGFPTVLIN
 
Nucleotide Sequence: 291 bp     [Download]
>gi|430741030|ref|NC_019892.1|:2964887-2965177 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGCCCATGCCTGCGGCTCGCGTCGGTGACATGCACGTCTGCCCTCTGATAACGGTTCTCGTGCCCCACG
TGGGAGGGCCGATCCTGCCACCGGGAGCCCTGACCGTTTTGATTGGTGGCCAGCCCGCCGCTCGGGTGGG
TGATCTTGCGGTCTGTGTTGGCCCTCCCGACGTGGTCGTGCTCGGAAGCTTTACGGTTCTCATCAGCGGT
CAGCCTGCCGCTCGCCTGGGCGATATCACCGCCCACGGTGGGGCCATCGTGATGGGCTTCCCCACGGTTC
TCATTAACTAA