SecReT6
Protein ID: 430743283
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2406
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2966635..2967642 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDL0DBU9
KEGG IDsaci:Sinac_2406
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-107, Aligned region: 11..318
Protein Sequence: 335 a.a.     [Download]
>gi|430743283|ref|YP_007202412.1| type VI secretion protein [Singulisphaera acidiphila DSM 18658]
MSNGLDQALFEEPYRFDFFQAVRILARLNPERAPVGREGPAHREVVRFLTHLSMSFPASSIRSLEPREDP
GTAPGMRVNFFGLTGPSGVLPHVYTELLMERSRLGDHSLAAFFDLINHRLISLFYRAWEKHHFIVARERG
GDEPFARHLFDLIGLGTTSLRNRHEFPDAALLPYSGFFARRQRPVVVLESLLRDYFELPIEIDQFVGRWL
QLESSDCSSLGTSGRNNELGGSLVLGSRAWDAQGKIRIRLGPLSFDRFQALQPDGPEFLAVAQMVRLFVD
LEFEFDVQLILKAEDVPACRLSSQGNGGARLGRHAWLRSRPLEKDVDDAVFTSSV
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2967642-2966635 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGTCCAACGGCTTAGACCAAGCGCTCTTCGAGGAACCCTATCGGTTCGATTTCTTTCAGGCGGTCAGGA
TCCTGGCCCGGCTGAACCCCGAGCGCGCCCCGGTCGGCCGCGAAGGACCGGCCCATCGCGAAGTCGTCCG
GTTCCTGACCCATCTCTCGATGAGCTTCCCGGCCAGCTCGATCCGCAGTCTCGAACCTCGCGAAGATCCA
GGCACGGCGCCCGGAATGCGGGTCAATTTCTTCGGCCTGACCGGTCCCTCGGGGGTGCTCCCGCACGTCT
ACACCGAACTGCTGATGGAGCGTTCGCGCCTGGGGGATCACTCGCTCGCTGCCTTCTTCGACCTGATCAA
CCACCGCCTCATCTCGCTCTTTTACAGAGCCTGGGAAAAGCATCATTTCATCGTCGCACGCGAACGTGGA
GGCGATGAGCCGTTCGCCCGCCACCTCTTCGACCTGATCGGGCTCGGGACCACCTCGCTTCGGAACCGCC
ACGAGTTCCCCGACGCCGCCCTGCTGCCCTACTCAGGTTTTTTCGCCCGAAGACAACGTCCCGTCGTGGT
CTTGGAGAGTTTATTACGCGACTATTTTGAACTCCCGATCGAGATCGACCAGTTCGTGGGCCGCTGGCTT
CAGCTCGAATCCAGCGACTGCTCCTCCCTCGGCACTTCCGGTCGAAATAACGAACTCGGTGGGAGCCTTG
TTCTCGGTTCCCGTGCCTGGGACGCCCAGGGCAAGATTCGGATTCGACTCGGTCCCCTCTCCTTCGACCG
GTTTCAAGCCTTGCAACCCGATGGGCCGGAATTCCTCGCCGTGGCCCAGATGGTGCGGCTCTTCGTGGAC
CTCGAATTCGAGTTCGACGTTCAGCTTATCCTGAAGGCCGAGGACGTTCCCGCCTGCCGCCTCTCCTCGC
AAGGCAATGGCGGAGCCCGCCTGGGGCGTCACGCTTGGCTCCGGAGCCGTCCGCTTGAAAAGGACGTCGA
CGACGCGGTCTTCACGTCGAGCGTTTAG