SecReT6
Protein ID: 430743284
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2407
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2967812..2969638 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDL0DD04
KEGG IDsaci:Sinac_2407
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-214, Aligned region: 5..608
Protein Sequence: 608 a.a.     [Download]
>gi|430743284|ref|YP_007202413.1| type VI secretion protein [Singulisphaera acidiphila DSM 18658]
MIDELLHYYNGELAYLRELGAEFAQKYPKVAARLLLESDKCEDPHVERLLEGVAFLTARIRHKIDDEFPE
ITDSLLGILYPHFQRPLPSLSIVQFVLNRAQANLAEGFTIERGSRINSRPVNGAPCPFRTTYPVTLWPIE
VEAARLDPDRVVVPGKPPGAVALLQLTLSCLGGAQFSQLSIDRLRFYLDGSGPLPYSLYELLHNNVCQVQ
VRSKLEDGRYESIVLPPDAIETVGFGRDEGMFDYPNRSFVGYRLIQEYFALPEKFLFFDVTGLQALFGKK
FAGSIELMFFLNRSPRNELPVQADTFRLGCTPVVNLYTTVAEPIALSQTQYKYRVVPDVHRQMATEVYSI
DRVTSVGGFLDEPLVYEPFYSMRHARQGETPGAYWYATRRASQVKDDPGTEVELSFVDPGFNPRLPASET
ITVHVTCTNRDLPSRLPFGGEQGDFELEGQGPVGRVRCLRKPTKPLRPPLGRNAQWRLISLLSLNHLSLA
DGEQGLDALHEILMIYNFADSAATRQQIAGVTGVSSRRVPVRTGRKIGSAVCLGVEVTVEFDETHFVGGG
VFLMASVLDRFLGLYTSINSFTRMVAKTRQREGILKQWPPRAGERTLL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2969638-2967812 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGATCGACGAGCTGCTGCACTACTACAACGGCGAGCTGGCCTACCTCCGCGAACTCGGGGCCGAGTTCG
CCCAGAAGTATCCCAAAGTGGCGGCCCGGCTACTCCTGGAGTCGGACAAGTGCGAAGACCCCCACGTGGA
ACGCTTGCTCGAAGGAGTGGCCTTCCTGACGGCGCGGATTCGCCACAAGATCGACGACGAGTTTCCGGAG
ATCACCGACTCGCTCCTGGGAATCCTCTACCCTCACTTTCAGCGCCCGCTCCCTTCGTTGTCCATCGTGC
AGTTCGTGCTCAACCGGGCGCAGGCGAACCTGGCTGAAGGGTTCACAATCGAGCGGGGGAGCCGGATCAA
CTCGAGACCGGTCAACGGAGCCCCCTGCCCATTCCGAACGACCTACCCGGTGACGCTCTGGCCGATTGAG
GTCGAAGCCGCGAGGCTTGACCCGGATCGGGTCGTTGTGCCCGGCAAACCCCCGGGGGCCGTTGCGCTGC
TCCAACTGACCCTCTCGTGCCTGGGGGGAGCGCAGTTCTCGCAGCTTTCGATCGATCGGCTTCGCTTCTA
CCTCGATGGATCAGGGCCGCTGCCTTACAGCCTGTACGAGCTCTTGCATAATAACGTTTGCCAGGTGCAA
GTTCGGAGCAAGCTTGAGGACGGGAGGTACGAATCCATCGTCCTTCCCCCTGACGCCATCGAGACCGTCG
GTTTCGGTCGCGATGAGGGGATGTTCGACTATCCGAACCGGTCGTTTGTCGGCTACCGCCTGATCCAGGA
ATATTTCGCGCTTCCTGAGAAATTCCTCTTCTTTGATGTGACCGGTCTCCAGGCGCTGTTCGGCAAGAAG
TTTGCCGGTTCGATCGAGTTGATGTTCTTCCTGAACCGATCCCCACGGAACGAGCTGCCGGTCCAGGCCG
ATACCTTCCGGCTTGGCTGTACCCCCGTGGTGAACCTCTACACCACGGTCGCCGAGCCGATTGCGCTCAG
TCAGACGCAATACAAGTATCGTGTGGTCCCCGACGTCCATCGCCAGATGGCGACCGAGGTCTACTCGATC
GATCGGGTGACCAGCGTCGGCGGGTTCCTCGACGAACCCTTGGTTTACGAGCCGTTCTATTCGATGCGCC
ACGCGCGGCAAGGGGAGACGCCGGGGGCCTACTGGTACGCGACCCGACGCGCCTCGCAGGTGAAGGACGA
CCCGGGCACCGAGGTGGAACTCTCGTTCGTCGATCCCGGCTTCAACCCGAGGCTGCCTGCCAGCGAGACC
ATCACGGTTCATGTCACTTGCACGAATCGTGACTTGCCGAGCCGTTTGCCCTTCGGCGGCGAGCAAGGGG
ACTTTGAACTCGAAGGCCAAGGGCCGGTGGGCCGCGTCCGCTGTCTGCGCAAGCCGACGAAGCCGCTCCG
TCCCCCCCTGGGCCGGAATGCCCAGTGGCGGCTGATCTCGCTCCTCTCGCTCAATCACCTCTCGCTGGCT
GATGGGGAGCAAGGGCTGGACGCCTTGCATGAGATCCTGATGATCTACAACTTCGCCGATAGCGCGGCGA
CCCGGCAGCAGATCGCAGGAGTGACCGGGGTGTCGAGCCGTCGGGTTCCGGTCCGCACCGGCCGGAAGAT
CGGCAGCGCCGTCTGTCTTGGGGTCGAGGTGACCGTTGAGTTCGACGAGACCCATTTCGTGGGGGGCGGC
GTCTTCTTGATGGCCAGTGTGCTGGACCGATTCCTTGGCCTTTATACGTCGATCAACTCATTTACCAGGA
TGGTCGCCAAGACGCGACAGCGCGAAGGAATCTTGAAGCAATGGCCACCCCGAGCCGGCGAACGGACCCT
CCTCTAA