SecReT6
Protein ID: 430743285
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2408
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2969644..2970129 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDL0DBG4
KEGG IDsaci:Sinac_2408
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-24, Aligned region: 38..143
Protein Sequence: 161 a.a.     [Download]
>gi|430743285|ref|YP_007202414.1| type VI secretion system lysozyme-like protein [Singulisphaera acidiphila DSM 18658]
MPRAPIEYSLLPSVLDRLIDHEPKVSTESQSGRNPLPAQIKESVKRDLEWLLNSKQLLAQWPEDLRQLEN
SVLTYGMPDFSSSTLSSANHQDKLRRTVEEAIARFEPRLSRVSVTTVEGREFDRSLRFRIDAMLRVDPAP
EPVTFDSVLQLTTRAFVVQGD
 
Nucleotide Sequence: 486 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2970129-2969644 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGCCGCGAGCTCCTATCGAATACTCTTTGTTGCCCTCGGTCCTCGACCGGCTGATCGACCATGAACCGA
AAGTCTCGACCGAGTCCCAGTCGGGGCGAAACCCGTTGCCAGCGCAGATCAAGGAGTCGGTCAAGCGCGA
CCTCGAATGGCTCTTGAACAGCAAACAGCTCTTGGCTCAATGGCCCGAAGATTTGCGGCAGCTTGAGAAC
TCGGTGCTGACCTATGGGATGCCAGACTTTTCCTCGTCGACCCTGAGTAGTGCCAACCACCAGGACAAGC
TGAGGCGTACGGTCGAGGAAGCAATCGCACGCTTTGAACCTCGCCTGTCGCGCGTCTCGGTCACGACCGT
CGAGGGGCGTGAATTCGACCGGAGCCTTCGGTTTCGGATCGACGCGATGCTCCGGGTCGATCCCGCCCCC
GAGCCCGTCACGTTCGACTCCGTGCTCCAGTTGACGACCCGGGCCTTCGTCGTGCAGGGTGATTAA