SecReT6
Protein ID: 430743286
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2409
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2970308..2970790 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDH1NA93
KEGG IDsaci:Sinac_7146, saci:Sinac_2409
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-39, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|430743286|ref|YP_007202415.1| hemolysin-coregulated protein [Singulisphaera acidiphila DSM 18658]
MAVDMFLKITDVKGESKDKSHSGEIEIESFSWGASQLGASSHGTGAGAGKVSMNDFHFVMRNNSASPTLF
LFCANGKHLKEAKLTCRKAGGTQQNFMVVTLSDVLVSSYQTGGSQGGEVPMDQISLNYSKVEIDYLAQDE
KGITKSAGKKHWDMKTNTGG
 
Nucleotide Sequence: 483 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2970790-2970308 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGGCTGTTGACATGTTTCTGAAGATCACTGATGTCAAAGGTGAATCAAAGGACAAGTCCCACTCCGGCG
AGATCGAGATCGAGTCCTTCAGCTGGGGAGCGAGCCAGCTCGGTGCCTCTTCGCACGGGACCGGAGCCGG
TGCCGGCAAGGTCTCGATGAACGACTTCCACTTCGTGATGCGGAATAACTCGGCGTCGCCGACCCTCTTC
CTCTTCTGTGCCAACGGCAAGCACTTGAAGGAAGCGAAGCTGACCTGCCGGAAGGCCGGTGGCACTCAGC
AGAACTTCATGGTGGTCACGCTGTCGGACGTGCTGGTCTCCAGCTACCAGACCGGCGGGTCGCAGGGGGG
CGAGGTCCCCATGGACCAGATCAGCCTGAACTACTCGAAGGTCGAGATCGACTACCTGGCCCAGGACGAG
AAGGGCATCACGAAGTCGGCAGGCAAGAAGCACTGGGACATGAAGACCAACACCGGTGGCTGA