SecReT6
Protein ID: 430743287
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2410
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2970946..2972439 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDL0DDH1
KEGG IDsaci:Sinac_2410
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-201, Aligned region: 68..491
Protein Sequence: 497 a.a.     [Download]
>gi|430743287|ref|YP_007202416.1| type VI secretion protein EvpB [Singulisphaera acidiphila DSM 18658]
MSGAAEQSQPTSAATSHEEVSLLDQIISQGRMARDEEQKTLAKDLIGEFVDQVMSGTMKVSKDTQAMINA
RIAQIDTLLSKQLNAVLHHEDFQKLEASWRGLHYVVHQSETGPTLKIKVMNVSKKDLLKDMERAPEFDQS
ALFKKVYEEEFGTFGGSPFGALVGDYEFSRSTQDIALLEKISNVAAAAHAPFMTAASPQLFNWDDFTEMS
GPRDLSKTFETNDYVKWRSFRDSEDSRYVGLCLPHILMRTPYGRDNTPVEAFNFEEDVDGADHQKYLWGN
AAYAFATRLTESFARHHWCAAIRGVEGGGLVSGLPVHTFSTDEGDVALKCPTEIAITDRREKELADLGFI
PLVHCKNTDYAAFFSAQSAQKSKLYNTDAANANARLSSQFQYIMAVSRIAHYLKSMMRDKLGSFMSRSQC
ETFLNTWIAQYVTTDDSASQETKSQYPLREARIDVMEVPGKPGAYKAIAFLRPHFQLDELTVSLRMVAEL
PPPASGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2972439-2970946 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGAGCGGAGCCGCCGAACAGAGCCAGCCGACGTCGGCTGCCACGTCGCACGAGGAGGTCAGCCTTCTCG
ACCAGATCATCTCGCAGGGCCGGATGGCCCGTGACGAAGAGCAGAAGACGCTCGCGAAAGACCTGATCGG
CGAGTTCGTCGACCAGGTCATGTCCGGGACCATGAAGGTGTCGAAAGACACTCAGGCGATGATCAATGCG
CGGATCGCGCAGATTGACACCCTGCTCTCCAAGCAACTGAACGCGGTCCTCCACCATGAGGACTTTCAGA
AGCTGGAGGCCTCCTGGCGCGGACTGCATTATGTCGTCCACCAGTCGGAGACGGGACCGACCCTCAAGAT
CAAGGTCATGAACGTCTCGAAGAAAGACCTTCTCAAGGACATGGAACGCGCCCCTGAATTCGATCAGAGC
GCCCTGTTCAAGAAGGTCTATGAAGAAGAGTTCGGCACATTCGGCGGTTCTCCGTTCGGGGCCCTGGTCG
GCGACTACGAATTCAGTCGTAGCACGCAGGACATCGCCCTGTTGGAGAAGATCTCGAACGTGGCCGCTGC
CGCGCACGCCCCGTTCATGACGGCGGCCAGCCCCCAGTTGTTTAACTGGGATGATTTCACCGAGATGTCG
GGCCCGCGCGATTTGAGCAAGACCTTCGAGACCAACGATTACGTCAAGTGGCGCTCGTTCCGCGACTCGG
AGGATTCACGCTACGTCGGCCTCTGCCTCCCGCATATTCTGATGCGGACGCCTTACGGACGTGATAACAC
ACCGGTCGAAGCATTCAACTTTGAGGAGGATGTCGACGGCGCAGACCACCAGAAGTACCTCTGGGGGAAT
GCGGCCTACGCCTTCGCGACCCGTTTGACCGAGTCGTTCGCCCGCCATCACTGGTGCGCCGCGATCCGAG
GGGTGGAAGGGGGCGGCCTCGTCAGTGGCTTGCCGGTCCACACCTTCAGCACCGATGAAGGGGATGTGGC
CCTGAAGTGCCCCACTGAGATCGCGATCACCGACCGTCGCGAGAAAGAACTTGCGGATCTCGGATTCATT
CCGCTGGTGCATTGCAAGAATACCGACTATGCGGCCTTCTTCAGCGCCCAGTCGGCCCAGAAGTCAAAGC
TGTACAACACCGACGCCGCCAATGCCAATGCCCGGCTCTCGAGCCAGTTCCAGTACATCATGGCGGTGTC
CCGGATTGCCCACTACCTGAAGTCGATGATGCGCGACAAGCTGGGCAGCTTCATGAGCCGCAGCCAGTGC
GAGACCTTCCTCAACACCTGGATCGCCCAGTACGTCACGACGGACGACTCGGCGAGCCAGGAGACGAAGT
CGCAATATCCGTTGCGCGAGGCCCGCATCGACGTGATGGAAGTTCCCGGGAAGCCGGGCGCCTACAAGGC
GATTGCGTTCCTCCGCCCCCACTTCCAGCTCGATGAGCTGACGGTCTCGCTACGGATGGTGGCTGAGCTG
CCGCCTCCTGCGTCGGGCGGTTGA