SecReT6
Protein ID: 430743288
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2411
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2972441..2972965 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDL0DBV3
KEGG IDsaci:Sinac_2411
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-59, Aligned region: 11..165
Protein Sequence: 174 a.a.     [Download]
>gi|430743288|ref|YP_007202417.1| type VI secretion protein [Singulisphaera acidiphila DSM 18658]
MPSFESTQHKLDRVRRPRVHLTYDVEVGGAIQVKELPFVMGVLADLSGKPIEALPKMKDRKFVEIDRDNF
NKVLNAIKPRLAFQVDNTLQNDNSKFNVELKFGHMNDFEPEQVVRQIEPLRKLLEARDRLSDLVTKMDGN
DTLEQLLQDVVNNTDSLKKLSSETGRAESKSEES
 
Nucleotide Sequence: 525 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2972965-2972441 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGCCGTCATTCGAGAGTACCCAACACAAGCTGGACCGCGTCCGTCGTCCCCGCGTCCATCTGACTTATG
ACGTTGAGGTCGGTGGTGCGATCCAGGTCAAAGAACTCCCCTTTGTCATGGGCGTTCTGGCTGACCTTTC
GGGCAAGCCGATTGAGGCGTTGCCCAAGATGAAGGACCGCAAATTCGTTGAAATCGACCGTGACAATTTC
AACAAGGTCCTCAACGCAATCAAGCCCCGGTTGGCGTTCCAGGTGGACAACACCCTTCAAAACGACAACT
CGAAGTTCAATGTTGAACTTAAGTTCGGTCATATGAATGACTTCGAGCCTGAGCAGGTCGTTCGCCAGAT
TGAGCCGCTTCGCAAACTTCTGGAAGCACGTGACCGGCTCTCCGACCTCGTGACCAAGATGGACGGTAAC
GACACGCTCGAGCAACTGCTCCAAGACGTGGTCAACAATACCGATTCGTTGAAGAAATTGAGCAGTGAGA
CGGGACGCGCCGAGTCCAAGTCGGAGGAGTCTTGA