SecReT6
Protein ID: 430743289
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2412
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2973186..2975075 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDL0DD10
KEGG IDsaci:Sinac_2412
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-17, Aligned region: 58..117
Protein Sequence: 629 a.a.     [Download]
>gi|430743289|ref|YP_007202418.1| type VI secretion-associated protein, ImpA family [Singulisphaera acidiphila DSM 18658]
MATTSVLNIDECLLPISGDNPAGRNLAYEAVYDELREARRAEDDTLQGDWQRKAKVADWERVIELGTEIL
QGQSKDLQVAAWITEALGRRHSFGGLRDGFLLMLGIQESFWETYYPEIDDGDLESRSGPFIFLESVVAPL
IRSLPLTRGFGDERYSYYRWQESRATDNAGLKSQDAMEALIAEGKITGQQFDDAVAQTPKPFYETLVEDL
RGCIDALKALDDSMDQRLGRDSPGVVAVRKALTDCRNVLEPILNLKRSLEPEPEDEGSEAEVADESEYAE
AESGYEEVPQVAAPRRRARPARSSGGPITSVDDARQRILEASAYLRENDPASPAPFLVVRALRMGDLYGQ
SQQPPDISVCEAPSSEVRMSLRRLAQEGEWSQLLEEAEQALGRPEGTAWLDAQRYALTAMAAGDIDRASA
ALACRSLLRTYLTDFPDLSNSELGDGTPTANSETRSWLLEEIVPPAPEPVASEPYEPVAYEPPPMEPYVP
EAQERAADEPADVWTQALELVQGRRINEAIDLIRRALVTASTGRERFQRKLQLAELCLMANRHQVALPLS
EDLARLVDEFRLEEWESEQLCARVWAAFYRCLRAVGAGSPAAEKLPQVFARLCRLDINQALALEGDSPH
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2975075-2973186 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGGCCACGACATCAGTGCTCAATATCGACGAATGTCTTTTGCCGATCTCCGGGGACAATCCGGCAGGAC
GTAACCTCGCCTACGAGGCCGTTTACGACGAACTGCGCGAGGCACGGCGGGCCGAAGACGATACCCTGCA
AGGGGACTGGCAGCGAAAGGCCAAGGTCGCCGACTGGGAACGGGTCATCGAACTGGGCACGGAGATCCTC
CAAGGCCAGTCCAAGGATCTGCAAGTCGCCGCCTGGATCACCGAGGCGCTCGGTCGGCGCCACTCGTTCG
GCGGGCTCCGCGACGGCTTTCTCCTGATGCTCGGGATCCAGGAGAGTTTCTGGGAGACCTATTATCCTGA
GATCGACGACGGTGATCTCGAGTCGCGCTCCGGCCCGTTCATCTTCCTCGAGAGTGTTGTCGCCCCCTTG
ATTCGAAGCCTCCCCCTGACCCGTGGATTCGGCGATGAGCGCTACTCCTACTATCGCTGGCAGGAGTCGA
GAGCGACCGACAACGCCGGGTTGAAAAGCCAGGACGCGATGGAGGCGTTGATCGCGGAAGGAAAGATCAC
CGGACAGCAGTTCGACGATGCGGTGGCCCAAACGCCGAAGCCCTTCTACGAGACCTTGGTTGAAGACCTT
CGTGGTTGCATTGATGCGCTCAAGGCTCTCGATGATAGCATGGATCAACGCTTGGGGCGAGATTCGCCGG
GCGTGGTCGCGGTGCGCAAGGCGCTCACCGATTGCCGCAACGTCCTCGAGCCGATCCTGAATCTGAAACG
ATCGCTCGAGCCCGAACCCGAGGATGAGGGCTCGGAGGCGGAGGTTGCGGACGAATCCGAATATGCCGAG
GCGGAGAGTGGCTACGAGGAAGTGCCGCAGGTCGCTGCTCCCCGGCGTCGCGCTCGCCCGGCTCGGTCCT
CAGGCGGCCCGATCACGAGTGTGGACGACGCGCGCCAGCGGATCCTCGAAGCAAGCGCCTATCTCCGGGA
GAACGATCCAGCCAGTCCGGCCCCTTTCCTCGTCGTCCGTGCCCTCCGGATGGGCGATTTGTATGGCCAG
TCCCAGCAGCCCCCGGACATCTCCGTCTGCGAAGCTCCCTCGAGCGAGGTCCGGATGAGCCTCAGAAGGC
TCGCTCAGGAGGGGGAGTGGAGCCAACTTCTGGAAGAGGCCGAGCAGGCGCTCGGTCGCCCCGAGGGGAC
AGCCTGGCTCGACGCACAACGCTACGCATTGACTGCGATGGCCGCAGGCGATATCGATCGCGCATCGGCC
GCGCTTGCCTGTCGGAGCCTGTTGCGGACGTATCTGACCGACTTCCCTGACCTGAGCAACTCGGAGCTGG
GCGACGGCACCCCGACGGCGAATTCCGAGACCCGAAGCTGGCTCCTGGAAGAGATCGTCCCTCCTGCTCC
CGAACCGGTCGCATCGGAACCTTATGAGCCGGTGGCTTATGAACCGCCGCCGATGGAGCCTTACGTTCCC
GAGGCCCAGGAGCGTGCGGCCGACGAACCGGCGGACGTCTGGACCCAGGCGCTCGAGTTGGTCCAGGGGA
GACGGATCAACGAAGCGATCGACCTGATCCGCCGCGCCTTGGTCACGGCCTCGACCGGCCGAGAGCGGTT
CCAGCGCAAGCTGCAACTCGCCGAACTCTGCCTCATGGCGAATCGCCACCAAGTCGCCCTGCCGCTTTCG
GAGGATCTGGCGCGGCTGGTGGACGAATTCCGTTTAGAGGAGTGGGAATCCGAACAGCTTTGCGCCCGAG
TCTGGGCGGCGTTCTACCGCTGCCTCCGCGCCGTCGGCGCCGGCAGTCCGGCTGCGGAAAAGCTGCCGCA
AGTTTTTGCACGCCTGTGCCGCCTTGATATCAACCAGGCACTGGCCCTGGAGGGAGACAGCCCTCACTAA