SecReT6
Protein ID: 430743290
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2413
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2975078..2975938 [-]
Productavirulence locus temperature-dependent protein secretion protein
NoteTagJ
UniProt IDL0DBG9
KEGG IDsaci:Sinac_2413
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.50E-33, Aligned region: 140..262
TPR_19 [PF14559], Evalue: 1.10E-06, Aligned region: 7..61
TPR_19 [PF14559], Evalue: 1.10E-06, Aligned region: 111..128
TPR_14 [PF13428], Evalue: 2.50E-06, Aligned region: 7..37
TPR_14 [PF13428], Evalue: 2.50E-06, Aligned region: 32..54
TPR_14 [PF13428], Evalue: 2.50E-06, Aligned region: 111..130
TPR_16 [PF13432], Evalue: 0.00038, Aligned region: 2..41
TPR_16 [PF13432], Evalue: 0.00038, Aligned region: 108..128
TPR_10 [PF13374], Evalue: 0.0042, Aligned region: 108..136
Protein Sequence: 286 a.a.     [Download]
>gi|430743290|ref|YP_007202419.1| avirulence locus temperature-dependent protein secretion protein [Singulisphaera acidiphila DSM 18658]
MNAKESLDRGQLTDAIRALNEEIKANPTDLELRTILFQFHCYAGDLVRAEKQLDVIRTKSTEIAYINGLR
VYQGLLNAERARTQLFEHGERPRFLVAPPESVTLHLDALDQVRAGRFDDARALLERAATTQEAIRGSADG
VEFDDFRDADDILSPVLEVFSTTGYYWVPWGHVQFLEVPKPKTLLDLLWAPAKLATYDGQLGEVYLPSLY
PGTSASPDGPLRLGRQTDWVDVGAGIIRGIGRKSLLVGEDVRTLQELGQAQFPLTEGKTSESASESSSVG
RPGDES
 
Nucleotide Sequence: 861 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2975938-2975078 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGAACGCGAAAGAGTCTCTGGACCGCGGTCAACTCACGGACGCGATCCGTGCTTTGAACGAGGAGATCA
AGGCCAATCCGACCGACCTCGAGCTTCGCACCATTCTCTTTCAGTTCCATTGCTATGCGGGCGATCTGGT
TCGCGCAGAGAAGCAGCTCGATGTGATTCGGACCAAGAGTACCGAGATTGCATACATCAACGGACTGCGG
GTCTACCAAGGACTCTTGAACGCGGAGCGGGCAAGAACTCAGCTCTTCGAGCATGGGGAACGCCCCCGTT
TTCTCGTGGCGCCACCGGAGAGTGTCACGCTGCACCTAGACGCCCTCGATCAGGTGAGAGCGGGACGCTT
CGACGACGCTCGTGCCCTGCTCGAGCGGGCGGCCACGACCCAAGAGGCAATACGAGGTAGCGCCGACGGG
GTGGAATTCGACGACTTTCGAGATGCGGATGACATTTTGTCCCCCGTGCTCGAAGTCTTCTCGACGACCG
GCTACTACTGGGTCCCTTGGGGGCACGTCCAATTCCTCGAAGTCCCCAAGCCGAAGACGTTGCTCGACCT
GCTCTGGGCCCCGGCAAAGCTGGCGACCTATGACGGCCAGTTGGGCGAGGTTTACCTGCCGAGCCTCTAT
CCGGGGACGTCGGCAAGCCCTGACGGTCCACTCCGACTGGGACGCCAAACCGACTGGGTGGACGTTGGCG
CCGGGATCATTCGAGGGATCGGGCGCAAGTCGTTACTGGTGGGTGAAGACGTGCGGACCCTGCAAGAACT
CGGCCAGGCGCAGTTTCCGCTCACGGAAGGCAAGACGAGCGAGTCGGCTTCGGAATCGTCGTCGGTGGGC
CGGCCGGGGGATGAATCCTGA