SecReT6
Protein ID: 430743291
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2414
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2976415..2977911 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDL0DCX9
KEGG IDsaci:Sinac_2414
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.40E-19, Aligned region: 306..365
FHA [PF00498], Evalue: 5.40E-19, Aligned region: 424..483
zf-ribbon_3 [PF13248], Evalue: 0.00015, Aligned region: 2..26
zf-ribbon_3 [PF13248], Evalue: 0.00015, Aligned region: 387..393
UPF0547 [PF10571], Evalue: 0.0006, Aligned region: 4..23
Prok-RING_1 [PF14446], Evalue: 0.0061, Aligned region: 2..24
zinc_ribbon_2 [PF13240], Evalue: 0.0075, Aligned region: 5..26
zinc_ribbon_2 [PF13240], Evalue: 0.0075, Aligned region: 386..393
Protein Sequence: 498 a.a.     [Download]
>gi|430743291|ref|YP_007202420.1| FHA domain-containing protein [Singulisphaera acidiphila DSM 18658]
MAQICPRCDATVGDDLTRCPSCGADLDPCRTIPPARPRQITPAKAPVSARKASPVERPDYSDERETATPP
PPPRPIKKIKPRPVAPQPTAQAPSAAPPAPQPAQPGPKLAYTPSSTTGEMAAYAPPAYPTPAPAPAESRG
GIRGWMIKMLGGAPAAPPQPQPHPAPAPVPPNYGYVPPGGAPPQPGAHPGYPPGVAPQAPAALHQAPPQG
HFQAPPPGWPDQPPVPGFGLQHPGPQGAGAPPHLDAPPSLLDPFGGGSDEYAKTQFLGGVDLDKLKIPKY
TFTLQILDNQGQWRDWGPIHANGLNVGRAKTSAEFPGLSSMAVRHMKLRYERTTLVVEDLGSINGVYLRV
IQPTELSDGMRFRVGNQTIEFHEPAAFEPVAPLVGEDGEEYCSRDLEPLAYLDLIRPNGQPGLRFPLTKP
DATIIGREGPNTHIALTSDNSVSGMHARVYRKDGKFILEDLKSRNGTFVHVLGSAKVTSGDVLLAGLVLF
RVVDHGNG
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|430741030|ref|NC_019892.1|:2976415-2977911 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGGCGCAAATCTGTCCCCGATGTGATGCGACTGTCGGCGACGATCTTACGCGCTGTCCCAGTTGCGGAG
CCGATCTCGACCCCTGTCGAACGATCCCACCGGCACGCCCGAGACAGATCACGCCGGCGAAAGCTCCGGT
CTCGGCTCGAAAAGCAAGTCCGGTGGAACGACCGGACTATTCCGACGAGCGGGAGACGGCCACCCCGCCT
CCACCGCCCAGGCCGATCAAGAAAATCAAACCACGGCCCGTTGCGCCACAGCCGACGGCCCAGGCCCCAA
GCGCCGCACCTCCGGCTCCGCAACCTGCGCAACCGGGCCCTAAGCTCGCTTACACACCGTCGTCGACCAC
CGGCGAGATGGCGGCCTATGCTCCTCCGGCCTATCCGACCCCGGCTCCCGCGCCGGCAGAAAGTCGAGGC
GGCATTCGTGGCTGGATGATCAAGATGCTCGGCGGAGCACCGGCCGCTCCGCCACAGCCTCAGCCCCATC
CCGCACCAGCGCCGGTTCCCCCGAATTACGGCTATGTGCCTCCCGGTGGAGCCCCGCCGCAGCCCGGGGC
ACATCCAGGGTATCCGCCAGGTGTGGCTCCTCAGGCCCCCGCAGCCCTGCACCAGGCCCCACCGCAAGGC
CATTTTCAAGCCCCCCCTCCCGGATGGCCCGATCAGCCACCTGTTCCTGGATTTGGGTTGCAGCATCCCG
GCCCACAAGGGGCTGGAGCACCCCCTCATCTCGACGCCCCTCCCTCCTTGCTCGACCCCTTTGGAGGGGG
GTCGGACGAGTATGCCAAGACCCAGTTCTTGGGGGGAGTCGACCTCGATAAGCTGAAGATCCCCAAGTAC
ACCTTCACGCTCCAGATCCTTGATAATCAAGGACAATGGCGTGATTGGGGCCCGATCCATGCCAACGGCC
TGAATGTCGGTCGTGCCAAGACGAGCGCCGAGTTTCCCGGGCTCAGCAGTATGGCCGTACGGCACATGAA
GCTACGTTATGAGCGCACAACGCTGGTCGTCGAGGATCTCGGATCAATCAACGGCGTTTACCTGCGCGTG
ATTCAGCCGACCGAACTGAGCGACGGAATGCGTTTCCGAGTTGGCAACCAGACGATCGAGTTTCACGAAC
CGGCCGCTTTCGAGCCGGTGGCTCCGTTGGTCGGAGAAGACGGCGAAGAATACTGTAGTCGGGATCTCGA
ACCGTTGGCCTATCTCGATCTCATCCGCCCCAACGGTCAGCCGGGCCTTCGCTTCCCGCTCACCAAGCCG
GATGCGACGATCATCGGCCGCGAGGGACCGAACACGCACATCGCCTTGACCAGCGACAATTCCGTGAGCG
GCATGCACGCGCGGGTCTATCGCAAGGACGGCAAGTTTATCCTCGAAGATCTGAAGAGCCGCAACGGCAC
GTTCGTCCATGTGCTGGGCTCGGCCAAGGTCACTTCAGGCGACGTGCTCTTGGCCGGCCTCGTCTTGTTC
CGAGTCGTCGATCATGGCAACGGCTGA