SecReT6
Protein ID: 430743293
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2416
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2979371..2979997 [-]
Producthypothetical protein
NoteTssL
UniProt IDL0DBV9
KEGG IDsaci:Sinac_2416
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-28, Aligned region: 4..201
Protein Sequence: 208 a.a.     [Download]
>gi|430743293|ref|YP_007202422.1| hypothetical protein Sinac_2416 [Singulisphaera acidiphila DSM 18658]
MTDPFASLVSPVFQTVLNLQQRLEAGENPPLGPEREQIVIALDEAARKAGISSQLSHDFELAKHALVYWI
DEILINSPWSHALEWRQQILEWDIYQERLRADRFFEKAHEAEVLANTDPLETYYLCVALGFRGKFVESQP
ELRAWAERIYNRIASSGLQPEKFLPDETLEREPLSPLPGQSILLAVSVLVSITALITLACFVLAVHPR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2979997-2979371 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGACCGACCCCTTTGCCAGCCTCGTTAGCCCCGTGTTCCAGACCGTGCTCAACCTCCAGCAACGTCTGG
AAGCGGGGGAGAATCCTCCGCTGGGGCCGGAACGGGAACAGATTGTCATTGCCCTCGACGAGGCCGCGCG
GAAGGCCGGCATCTCGAGCCAGTTGTCGCACGACTTTGAACTCGCCAAGCACGCCTTGGTGTACTGGATC
GACGAAATCCTGATCAATTCACCCTGGTCGCACGCCCTGGAATGGCGGCAGCAGATCTTGGAGTGGGACA
TTTATCAGGAACGGCTTCGCGCCGATCGCTTTTTCGAGAAGGCCCACGAGGCCGAAGTCCTCGCCAATAC
CGACCCCTTGGAGACGTACTACCTGTGCGTCGCCCTGGGGTTTCGCGGGAAGTTCGTGGAGAGTCAGCCG
GAACTGCGCGCCTGGGCGGAACGGATCTATAACCGAATTGCCTCGAGCGGTCTTCAGCCTGAAAAATTCC
TGCCGGACGAGACGCTCGAGCGTGAGCCCTTGAGTCCCTTGCCGGGGCAGTCGATCTTGCTGGCCGTTAG
CGTCTTGGTCTCGATCACGGCCTTGATTACCCTCGCCTGCTTCGTTTTGGCCGTGCATCCACGATAA