SecReT6
Protein ID: 430743294
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2417
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2980007..2981401 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDL0DD16
KEGG IDsaci:Sinac_2417
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-88, Aligned region: 18..431
Protein Sequence: 464 a.a.     [Download]
>gi|430743294|ref|YP_007202423.1| type VI secretion protein [Singulisphaera acidiphila DSM 18658]
MASRPIHWHEGMFLRPQHFQVADRNVRETLRDSEDWFHPFNWGVRLVEFDREAFGNYSAVLRSCEARFKD
GTKIAIPADGTVDPVELRSALANSGSVMIYLAIPTLQAGRANVEEVPTANGPRYWVDELEITDENTGSEE
QALLVRRTRARLLLSTQDHTGYEILPLARVERSAQLEAPPQLDVDYVPPLLVLDAWTPLWQMIQSLYHQI
GAKVDQLASQIVDRSISFDSQVPGDAERLLKLATLNGALSAFESIVFIRGLTPLLLFHELCRLVGQLAIF
MDARRPPALPPYDHEDIGGCFYTVIKYIQLGLDTIAPSAFEKRYFEKNGERLQVSLEPAWLSSTKTLFLG
VETELGDDDCEQLLRSMDMKLGSTSRVEQIFKQALRGLKLVPIVRPPRALPAGTGIVYYQIERDQVFWRD
VADTCSMAIRMNLARATFQSDRILSVVPPKGSKTTNLQFALFVI
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2981401-2980007 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGGCAAGCCGTCCGATTCACTGGCATGAAGGCATGTTCCTGCGCCCTCAGCACTTCCAGGTCGCTGACC
GGAATGTTCGGGAAACCCTTCGCGATTCCGAAGATTGGTTCCACCCCTTCAACTGGGGCGTCCGATTGGT
GGAGTTCGACCGCGAGGCGTTCGGCAATTACTCGGCCGTCCTGCGGTCGTGCGAGGCCCGTTTCAAGGAT
GGGACCAAGATCGCGATCCCGGCTGATGGCACCGTCGACCCCGTGGAACTGAGGAGCGCACTGGCGAACT
CAGGGTCGGTGATGATCTACCTGGCGATCCCCACGCTCCAGGCCGGGCGAGCCAACGTGGAGGAAGTCCC
GACCGCCAACGGTCCGCGATACTGGGTCGACGAGTTGGAAATCACCGACGAGAACACAGGGAGCGAGGAG
CAGGCGCTCCTGGTCCGTCGGACCCGAGCGCGGTTGCTGCTTTCGACTCAGGATCATACCGGCTATGAAA
TTCTTCCTCTGGCCCGGGTGGAGCGGTCCGCTCAACTCGAAGCGCCGCCACAGCTCGACGTCGACTACGT
TCCTCCGTTGCTTGTGCTGGACGCCTGGACGCCGCTCTGGCAAATGATCCAGTCGCTCTATCATCAGATC
GGGGCCAAGGTCGATCAACTCGCCTCCCAGATCGTGGACCGGAGCATCTCGTTCGACAGCCAGGTTCCGG
GAGATGCGGAGCGCCTGCTCAAGCTGGCCACGCTCAACGGGGCGCTTTCGGCGTTCGAGTCCATCGTCTT
TATCCGGGGACTCACGCCCCTTTTGCTTTTTCACGAGCTTTGCCGGTTGGTTGGCCAACTCGCGATCTTC
ATGGACGCCCGGCGGCCCCCTGCCCTTCCCCCGTACGACCACGAGGACATCGGCGGTTGTTTCTACACTG
TGATCAAGTATATTCAGCTCGGGCTCGATACGATCGCTCCGTCGGCGTTCGAGAAGCGATACTTCGAGAA
GAATGGGGAACGGCTTCAGGTCAGCCTGGAACCGGCCTGGTTGAGCAGTACGAAGACCCTCTTTCTCGGT
GTCGAGACGGAGCTGGGGGACGATGACTGCGAACAGCTTCTCCGGTCGATGGATATGAAGCTGGGAAGCA
CGTCACGGGTCGAGCAGATCTTCAAGCAGGCCTTGCGTGGTCTCAAGCTGGTGCCGATCGTGCGGCCGCC
TCGTGCCTTGCCGGCGGGCACCGGCATCGTCTACTACCAGATCGAACGTGACCAGGTGTTCTGGCGTGAC
GTGGCGGATACTTGTTCGATGGCGATCCGAATGAACCTGGCGCGTGCGACCTTCCAGAGTGATCGCATCC
TGTCGGTTGTGCCGCCCAAGGGAAGCAAGACCACCAACCTCCAATTCGCTCTGTTCGTCATCTAA