SecReT6
Protein ID: 430743297
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2420
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2987425..2990091 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDL0DDI1
KEGG IDsaci:Sinac_2420
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-40, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 1.60E-40, Aligned region: 619..785
AAA [PF00004], Evalue: 2.80E-18, Aligned region: 225..338
AAA [PF00004], Evalue: 2.80E-18, Aligned region: 625..723
ClpB_D2-small [PF10431], Evalue: 3.70E-14, Aligned region: 793..867
AAA_5 [PF07728], Evalue: 5.80E-14, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 5.80E-14, Aligned region: 624..742
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 492..535
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 614..658
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 689..712
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 780..821
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 342..383
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 622..646
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 686..718
AAA_19 [PF13245], Evalue: 2.40E-07, Aligned region: 223..253
AAA_19 [PF13245], Evalue: 2.40E-07, Aligned region: 622..652
AAA_19 [PF13245], Evalue: 2.40E-07, Aligned region: 732..752
AAA_17 [PF13207], Evalue: 1.50E-06, Aligned region: 225..285
AAA_17 [PF13207], Evalue: 1.50E-06, Aligned region: 623..662
AAA_25 [PF13481], Evalue: 2.90E-06, Aligned region: 225..294
AAA_25 [PF13481], Evalue: 2.90E-06, Aligned region: 605..648
Sigma54_activat [PF00158], Evalue: 6.10E-06, Aligned region: 219..241
Sigma54_activat [PF00158], Evalue: 6.10E-06, Aligned region: 595..738
Clp_N [PF02861], Evalue: 1.10E-05, Aligned region: 25..74
Clp_N [PF02861], Evalue: 1.10E-05, Aligned region: 105..141
IstB_IS21 [PF01695], Evalue: 4.10E-05, Aligned region: 218..245
IstB_IS21 [PF01695], Evalue: 4.10E-05, Aligned region: 624..643
IstB_IS21 [PF01695], Evalue: 4.10E-05, Aligned region: 811..848
AAA_14 [PF13173], Evalue: 6.90E-05, Aligned region: 225..358
AAA_14 [PF13173], Evalue: 6.90E-05, Aligned region: 623..705
AAA_14 [PF13173], Evalue: 6.90E-05, Aligned region: 830..865
TIP49 [PF06068], Evalue: 7.50E-05, Aligned region: 225..246
TIP49 [PF06068], Evalue: 7.50E-05, Aligned region: 274..305
TIP49 [PF06068], Evalue: 7.50E-05, Aligned region: 588..659
TIP49 [PF06068], Evalue: 7.50E-05, Aligned region: 777..806
NACHT [PF05729], Evalue: 9.60E-05, Aligned region: 225..253
NACHT [PF05729], Evalue: 9.60E-05, Aligned region: 624..649
Zeta_toxin [PF06414], Evalue: 0.00017, Aligned region: 225..246
Zeta_toxin [PF06414], Evalue: 0.00017, Aligned region: 614..664
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 225..248
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 625..654
ResIII [PF04851], Evalue: 0.00082, Aligned region: 216..247
ResIII [PF04851], Evalue: 0.00082, Aligned region: 295..306
ResIII [PF04851], Evalue: 0.00082, Aligned region: 596..655
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 215..242
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 622..635
IPT [PF01745], Evalue: 0.0014, Aligned region: 463..545
IPT [PF01745], Evalue: 0.0014, Aligned region: 622..644
AAA_28 [PF13521], Evalue: 0.0014, Aligned region: 225..268
AAA_28 [PF13521], Evalue: 0.0014, Aligned region: 624..644
SRP54 [PF00448], Evalue: 0.0019, Aligned region: 225..247
SRP54 [PF00448], Evalue: 0.0019, Aligned region: 623..658
MscS_porin [PF12795], Evalue: 0.0024, Aligned region: 66..129
MscS_porin [PF12795], Evalue: 0.0024, Aligned region: 460..544
MscS_porin [PF12795], Evalue: 0.0024, Aligned region: 592..615
Arch_ATPase [PF01637], Evalue: 0.0034, Aligned region: 204..244
Arch_ATPase [PF01637], Evalue: 0.0034, Aligned region: 278..373
Arch_ATPase [PF01637], Evalue: 0.0034, Aligned region: 623..665
Arch_ATPase [PF01637], Evalue: 0.0034, Aligned region: 690..719
RNA_helicase [PF00910], Evalue: 0.0038, Aligned region: 226..246
RNA_helicase [PF00910], Evalue: 0.0038, Aligned region: 625..646
DUF258 [PF03193], Evalue: 0.0091, Aligned region: 218..244
DUF258 [PF03193], Evalue: 0.0091, Aligned region: 623..636
Protein Sequence: 888 a.a.     [Download]
>gi|430743297|ref|YP_007202426.1| type VI secretion ATPase, ClpV1 family [Singulisphaera acidiphila DSM 18658]
MGVDSGAVIKTLNKTCVNSLQAAAGLCLSRTNYSVEVEHWLLKLTEVHDSDLARVFRHFEVNTSHLQRDL
TKALDRLKTGNARTPMLSPSIDELIRSAWVLASLQYQSRQVRSGFLLLALLEDEQLGRLARDASPEFAKI
KVETLASGMTSLIAGSAEEESPAREAEGQATPSRGAATQTPALDQYTINLTERARAGQIDPVLGRDAEVR
QMVDILIRRRQNNPILTGEAGVGKTAVVEGLAARIAAGDVPEPLRKVVLRTLDLGLLQAGAGVKGEFENR
LKQVIAEVKASPVPIVLFIDEAHTMIGAGGQAGQGDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVIRVEEPSEEKAIVMMRGITAMLESHHGVRILDEAVEGSVKLSARYIPGRQLPDKSVSLLDTAC
ARVAISQTAIPPAVEDCRRRIDHLKVEIGILERENVTGVQHDARLAETREALAKSESLLVELEKRWKEER
TLVQTIRGLAEQIEKAHAAKNGKAGELPTIETPAQPDKLKTELATRTLELSALQGDSPLMHVNVDSQTIA
AVIAGWTGIPVGKMLADEIRTVLNLKTKLEERVIGQAQALEAVSQRIRTARANLTDPRRPIGVFLLVGPS
GVGKTETAISLADSLYGGERNLVVINMSEYQEAHTVSGLKGSPPGYVGYGEGGVLTEAVRRKPYCVVLLD
EVEKAHPDVMELFFQVFDKGTLEDGEGRVIDFKNTVILLTSNVGTETTMALCADEDTTPEAAGLVEALRP
ELLKVFPPALLGRLVVVPYYPISDEVMKQIVRLQLDRIVRRVRENHKAAFTYSEEIVANIASRCKEVHSG
ARNVDQILTRSLLPELSQEFLARMAEGDVLTSVYVDVDEQGNFRYQFS
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2990091-2987425 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
ATGGGAGTCGATTCGGGAGCGGTCATCAAGACGCTCAATAAGACATGTGTCAACTCCCTCCAGGCGGCGG
CCGGGCTCTGCCTGTCACGCACGAATTACAGTGTTGAGGTCGAGCACTGGCTGCTGAAATTGACTGAGGT
GCACGATAGCGACCTGGCCCGGGTCTTCCGCCACTTCGAGGTCAACACGTCGCATCTTCAGCGCGATCTG
ACCAAGGCACTCGATCGATTGAAGACCGGCAATGCGCGAACGCCGATGCTCTCTCCCTCGATCGACGAGT
TGATCCGCTCGGCGTGGGTGCTCGCCTCCCTCCAATATCAGTCACGACAGGTCCGCTCCGGGTTCCTCCT
CCTCGCCCTGCTCGAGGATGAACAACTCGGCCGGCTGGCCCGCGACGCGTCGCCGGAGTTCGCCAAGATC
AAGGTGGAGACCCTCGCGAGCGGAATGACGAGCCTGATCGCCGGCTCGGCTGAGGAGGAATCGCCGGCGC
GCGAGGCCGAGGGGCAAGCGACGCCTTCCCGTGGTGCGGCAACCCAGACCCCCGCGCTCGATCAATACAC
GATCAACTTGACCGAACGGGCGCGGGCAGGCCAGATCGATCCGGTTCTCGGCCGCGATGCCGAGGTCCGT
CAGATGGTCGATATCCTGATTCGCCGTCGCCAGAACAACCCGATCCTGACCGGTGAGGCGGGGGTCGGCA
AAACGGCCGTCGTCGAGGGCCTCGCGGCTCGGATCGCGGCGGGCGACGTTCCCGAGCCGCTCCGCAAAGT
GGTTCTGAGAACCTTGGACCTCGGCCTGCTCCAGGCGGGAGCCGGGGTCAAGGGGGAGTTTGAGAATCGG
CTCAAGCAAGTGATCGCCGAGGTGAAAGCCTCACCCGTGCCGATTGTCCTCTTCATCGACGAAGCACACA
CCATGATCGGCGCAGGGGGACAGGCCGGTCAGGGGGATGCGGCCAACCTGCTCAAGCCGGCCCTGGCTCG
AGGCGAACTCCGTACGATCGCGGCGACCACTTGGGCCGAGTACAAGAAATACTTCGAGAAAGATGCGGCC
CTGGCCCGACGATTCCAGGTGATCCGGGTCGAGGAGCCGAGCGAGGAAAAAGCGATCGTGATGATGCGTG
GCATTACCGCCATGCTCGAGAGTCATCACGGGGTGCGGATCCTCGATGAGGCCGTAGAGGGATCGGTCAA
GCTCTCCGCGCGCTATATCCCCGGCCGACAACTTCCCGACAAGTCGGTGAGCCTCCTCGATACGGCCTGT
GCTCGCGTCGCGATCAGCCAGACCGCAATCCCGCCGGCCGTCGAGGATTGCCGCCGCCGGATCGATCACC
TCAAGGTCGAAATCGGGATCCTCGAACGCGAAAATGTGACGGGAGTCCAACACGACGCACGGCTCGCCGA
GACCCGGGAGGCACTTGCCAAGTCCGAGTCCCTCCTGGTCGAGCTTGAGAAACGGTGGAAAGAGGAACGA
ACGCTTGTTCAGACCATCCGAGGGCTCGCCGAGCAAATTGAGAAGGCACATGCCGCCAAGAACGGCAAGG
CCGGCGAGCTGCCGACCATCGAGACCCCGGCCCAGCCAGATAAGCTCAAGACCGAACTCGCCACTCGAAC
CTTGGAGTTAAGCGCCCTCCAAGGCGATTCGCCGCTGATGCACGTGAATGTTGATTCTCAGACGATCGCC
GCCGTGATCGCCGGCTGGACCGGGATCCCGGTGGGCAAGATGCTGGCCGATGAGATCAGGACGGTCTTGA
ACCTCAAGACGAAGCTGGAAGAACGCGTGATCGGCCAGGCGCAAGCTCTCGAGGCCGTCAGCCAACGCAT
TCGGACCGCTCGGGCCAATCTGACCGACCCTCGTCGCCCGATCGGTGTCTTCCTCCTGGTCGGACCCAGC
GGCGTGGGCAAGACGGAGACCGCGATCTCACTGGCCGACTCGCTCTATGGCGGCGAGCGGAACCTTGTCG
TTATCAATATGTCCGAGTATCAAGAGGCGCATACTGTCTCGGGTCTGAAAGGCTCACCACCCGGTTACGT
TGGCTACGGCGAAGGGGGAGTTCTCACCGAGGCTGTCCGGCGCAAGCCTTACTGCGTGGTCCTGCTCGAC
GAGGTGGAGAAGGCCCACCCGGACGTGATGGAACTCTTCTTCCAGGTCTTTGATAAGGGGACGCTCGAGG
ACGGTGAAGGACGCGTGATCGACTTCAAGAACACGGTCATCCTTCTGACCTCGAATGTCGGGACAGAGAC
CACCATGGCGCTCTGTGCCGATGAGGATACCACGCCCGAAGCCGCCGGCCTGGTCGAGGCGCTCCGCCCC
GAACTCCTCAAGGTCTTCCCCCCGGCCTTGCTCGGACGCCTGGTCGTCGTCCCTTACTATCCGATCTCCG
ACGAGGTGATGAAGCAGATCGTCAGGCTCCAACTCGACCGGATCGTCAGGCGGGTTCGCGAGAACCACAA
AGCCGCCTTTACCTACAGCGAGGAAATCGTCGCGAACATTGCCAGCCGTTGCAAGGAGGTCCACAGCGGA
GCACGCAATGTCGACCAGATCTTGACCCGCAGTCTTCTGCCGGAACTTTCCCAGGAGTTCCTCGCCCGTA
TGGCCGAGGGCGACGTCCTCACCAGCGTTTATGTGGATGTCGACGAACAAGGGAACTTCCGCTACCAATT
CTCCTGA